ELF>O@A@8 @<<@@@UU v v (--- $$Std PtdQtdRtd 00GNUGNUO݇=XU@ 1~0 @J\Bb~ pvXS5 mK=$SmC^? [摪`V.~Pi"߾KICVz89 eg'p"&|A%(Z|Py#(kI-eBLK ,jz ap`_ Ugf ~, 1<3F".w a O /  P1 01 1 e `0 1= 0Y 0c 2 /I 0/ / 0" p1T @0U R[p 1Z /__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizefinfo_objects_new_emalloczend_object_std_initobject_properties_initmagic_closezend_object_std_dtormagic_versionap_php_snprintfphp_info_print_table_startphp_info_print_table_rowphp_info_print_table_end__stack_chk_failzend_parse_parametersmagic_openmagic_loadzend_restore_error_handlingphp_check_open_basedirexecutor_globalszend_replace_error_handlingexpand_filepath_with_modezend_throw_exceptionphp_error_docrefzend_parse_method_parametersmagic_setflagszend_throw_errorphp_stream_locate_url_wrapper_php_stream_open_wrapper_ex_php_stream_stat_php_stream_freemagic_streammagic_errormagic_errnophp_le_stream_contextzend_fetch_resource_exmagic_getflagsfile_globalsphp_stream_context_allocstrlenmemcpyzend_argument_must_not_be_empty_errormagic_bufferphp_file_le_pstreamphp_file_le_streamzend_fetch_resource2_ex_php_stream_tell_php_stream_seekzend_zval_value_namezend_argument_type_errorzend_string_init_internedstd_object_handlerszend_register_internal_class_with_flagszend_register_long_constantzend_known_stringscompiler_globalszend_hash_str_findzend_add_attribute__zend_mallocget_module_efreestrrchrzend_spprintfaccessstrstrstrcmp__ctype_b_locstrtoul__ctype_tolower_loc_php_stream_write__errno_locationmemcmp_ereallocstrchr_ecalloc_emalloc_160stderr__fprintf_chkzend_error_noreturn__printf_chkfputc_php_stream_get_linestrtolstrncmp_emalloc_largestrtoullstrtodphp_strlcpypcre_get_compiled_regex_cachefwriteqsort_php_stream_opendir_php_stream_readdir_estrndup_php_stream_read_emalloc_40_estrdupgetenvfstatlseekmktimememsetstrerrorzend_vspprintf_php_stream_castpcre_get_compiled_regex_cache_exphp_pcre_replace_impl_emalloc_24__isoc99_sscanffcntlmemchrmagic_compilemagic_checkmagic_listmagic_descriptormagic_filemagic_setparammagic_getparam__vasprintf_chkgmtime_rasctime_rstrcspntzsetlocaltime_rstrftimefputszend_str_tolower_dup__ctype_toupper_locphp_pcre_pce_rephp_pcre_create_match_dataphp_pcre_mctxphp_pcre2_matchphp_pcre_free_match_dataphp_pcre_match_implzend_hash_index_findzval_ptr_dtorzend_memnstr_exlibc.so.6fileinfo.soGLIBC_2.3.4GLIBC_2.8GLIBC_2.7GLIBC_2.14GLIBC_2.33GLIBC_2.4GLIBC_2.2.5GLIBC_2.3/opt/alt/libssh211/usr/lib64:/opt/alt/curlssl30/usr/lib64:/opt/alt/sqlite/usr/lib64:/opt/alt/libxml2/usr/lib64:/opt/alt/libicu71/usr/lib64:/opt/alt/libwebp/lib64  ti ii ii ii ui  ii  R PR  !! S!$0!8!V@! $`!h!Xp!#!ҡ!@U!`#"" S" '0"8"pa@"&`"̡h"@Up"&"ܡ"V"%""X"@%""Z#%#֡##֡#Ǡ$ $@$`$֡x$Ǡ$ $$֡$Ǡ$#$ %`%h%%%֡%Ǡ% %&& &@&֡X&Ǡ`& x&&&&֡''('@'֡X'Ǡ`'#x'''p''q''Pq' '@f(dğ(nğ((tğ8(|ğH(ğX(ğh(ğx(ğ(ğ(ğ(ğ(ğ(ğ(ş(ş("ş)7ş)Aş()^ş8)gş@)ǟH)ǟP)ٟX)ǟ`)ǟh)p)ǟx)ǟ))ǟ)ǟ)ǟ)ǟ)ǟ)*ȟ)ǟ)ǟ)ǟ)ǟ)ȟ)ȟ)ȟ)ȟ)&ȟ*/ȟ*8ȟ*?ȟ*Gȟ *Oȟ(*Xȟ0*aȟ8*iȟ@*nȟH*rȟP*{ȟX*ȟ`*ȟ*(ٟ*2ٟ*F؟*<ٟ*Mٟ*Xٟ*cٟ +oٟ(+ٟ0+ٟ8+ٟp+ٟx+ٟ+ٟ+ٟ+ٟ+ٟ,ٟ,ٟ , ڟ(,%ڟ`,ٟh,oٟp,ٟx,oٟ,ٟ,ٟ,ٟ,ٟ,Bڟ,Sڟ,ٟ,ٟ,ٟ,ٟ,ٟ,ٟ,ٟ,ٟ-Bڟ-gڟ -ٟ(-ٟ0-yٟ8-ٟ@-rڟH-ٟP-}ڟX-ڟ`-ڟh-gڟp-ڟx-gڟ-ڟ-gڟ-ڟ-gڟ-ڟ-gڟ@4H4"P4^p4Ox44// ///?/H/\//k/m/u/}0 0(00080@0H0P0X0 `0 h0 p0 x000000000000000001 1!1"1# 1$(1%01&81'@1(H1)P1*X1+`1,h1p1-x1.1/1011121314151617118191:1;1<1=2>2@22A 2(2B02C82D@2EH2P2FX2G`2Ih2Jp2Kx2L2M2N2O2P2Q2R22S2T2U2V2W2X2Y22Z3[3]3^3_ 3(3`03a83b@3cH3dP3eX3f`3gh3hp3ix3j33l3n3o3p3q3r3s3t3u3v3w3x3y3z3{4|HHHtH5%hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%DATH dH%(HD$1Ld$ dLAЉH1 1HOH5O1LH5OHD$dH+%(t*H A\1H5O1cHL$HyO11{HL$1HiQ1H]TH5bO11(IH5>O1111H4Q HޟH<H5N11H5,Q1h HO11>AD$  % 1Hu1H<$i@H=HH9tHݟHt H=H5H)HH?HHHtHݟHtfD=u+UH=ݟHt H=nΟd]]wATUHHG )HcHH@HHL`LKHLHL]A\DUHH/H]FfDAUATUSHH $HHdH%(H$81HI,HD${(HD$HD$HL$HT$1E1LD$H5LtWH|$uxHD$|$HHHt$HMH|$ IEHhH$8dH+%(HH[]A\A]@H|$Ht?tMtH|$ uH۟H-AD$DHL$HT$LD$H5KLk _1HT$ HC HxHC H@H|$RDH=!@^t1@|Df.f.f.f.f.f.1ff.fHtKUHH?HMH9t Ht.H]%DH}HtH} Htfff.@AUATUHSHHdH%(HD$1tH/oHPHHE}H@HqHDH9w$8HQHH9tHH9v@HM@AIA)CDtjL1IL mDDHFQNH<$t+cDH$HT$dH+%(H[]A\A]@H<$L1IL DDHPH5PHHufDH9H9@HCH9H HyHAu HfHfDH6H?AAWAVAUATUHSH(L.dH%(H$1AE A}-IÀ&HA\$IÀDB uA$Àu'HA\$IÀuDX uHt$1LkIH=HD$D0EtHBDp E}1MtH$dH+%( H([]A\A]A^A_fD-t "C<w A] I:Dx -t~ހ/t1H5NHA} /v1ɺ/H5SHLH5NH1AE AE6AMH5R1HH5~NH1aIM Ht$AH5RHH123AUATUHSHH+L D+CDltu#HAI]HD[]A\A]CDBu@4t7E@1tO@2uAHDHE1[D]A\A]A@8uAfA@ǀuJS"IIDBu*CvC7B[C[C[f.HxI6H7dH%(H$h1H纰HI06H$HH$HDŽ$D$t DH$hdH+%(uHx,ff.ATI@tuA<9wGH( qHHt LA\HPHt McLA\M䩄uIGD@tH5J1DLLA\fDAVAUIATUHSHx-HHLDc Mt1CD9t)PfHSoMA [E]A\A]A^@ELIIL7IHtKKAHH1HyHHǁx HH) HLDc Ck[L]LA\A]A^HtSATIUSH_H9t%HH[H}HtH;I9uI|$Ht[L]A\AWHAVAUATIUSLHH<$tHRHHHJ,}E<$MEAǀuE1E&H;\$PHG\$PE1HAAǀut$ t$ IAI8GuH|$`Ht!IF|-G<.EI9uDL9l$PuQT$htBD-H$@D@t!HT$XH<$MLH5G1@1H[]A\A]A^A_IAIB uAAǀtVH|$`HtUD$htBD-MuH<$1LH5$GH uE11tD$htHT$XH<$ELH5K>D$ht덋L$ht H$HD$PL$PHT$X1MH<$IH5#KHT$XH<$1H5BKHIҋVIHeFjALPH/PjPH6ZH(DHIҋVIH1FjA0LPH40PjH6H(DHIҋVIHEjA8LPH0PjxH6H(DHt?UHH?[H}RH}0H} H}H]fDAT0UH4IHH^ID$0ID$ ID$(ID$ ID$HHE@AD$HID$P1fAD$dH2dAD$@I$ID$ID$XIDŽ$(IDŽ$pIDŽ$ I$ADŽ$ fA$HL]A\{LE1jHL]A\ff.@SDGHDA v*A@<-w'*wAHC0HcH>fDEuDH0DG@HtyA@HN5HHxSHHD>vnD^/xS 1+SHHHN€[H tYCDfDS>w J߀{H5/Hc H>fDfAw @|[HHS +8-iSH)кHHN€[HfCD+H f.H f.S DƒK HC 1f\}$7wHHu 7tSHHHuf.HHD1Ҹ HHHDHHI]tHufD^t{t @Ht }uzz/KHHHHN€[HD*SHºHHN€[HfDxuH fHHHH@H6H81H5@1@&fD1H=gEڼ1H@DHQ@ff.ATIUHSwH?At$I<$HH9tH9[]A\@[LH]A\qAWAVAAUATUSHLH|$L9cDIwE11H=fDH[IHf@v@nvqtfabVQaFAr61A\$FH[]A\A]A^A_AH4=L1 @4IHtJ1u#fDNHHt HσH xHt L)HH2y NHuHt HL)HH1@HH HI9vÐNtw!tLufDt%H1H@1葍HHDff.@AWAVAUATUSHH $HH $Ht$DIH5O$HHT$8HL$(1LD$0E1dH%(H$ 1IWPHD$Hk H$fHD$ Ht$H$Ht$)$IGXHL$ Ht$H|$[IHwAfA9GddH$HID8 u HD$ A$LH$\Hx>t9s*LuHD$(IGXHfDH$JHp D$E1AD$H@HH )ȃ~#LH5^?1迶D$H$D9$AD$$DH@HHH,1H}HHEHDžHH)Hf]D$ EH$&uHH$MH$(f}u EoH$?-uHH$MH$L$1LAGD@VH55L1x@@HH$MȃƒEˆEH$8&HH$MEH$LhL$DpA~uIEM@H$EuIAtEIEH$EuIA(uIEMH$EuIIAI DAu[A-tUMuL$A})u!}MuL$A})AGD@ H5@9L1.L1LL$EL9$uAGD@LH53L1HHdHxHH$1HHHǀH)1HH H$,H$LLLd$HL|$P HL$XH[H,LH$H)ITTDHD@H,HH8HH6H$AD$ D$$:0uDHD$(H5(7L1.vAGD@kH5I2L1荮UHL$81H1L"HD$(7AGD@H5 2L1=H|$HFH|$HHWDP EH$MP-u@ L$E A<$~Dm1EA EA<$ktqA;wH bLE 1I|$H$5H$H$EHEH$*L$L$A$Àu.KHID$H$HÀu DQ uK߀=w.H  HH(E=L$A<$xE<; H `HR <&<#!<'EH$LHZE DE:L$L$ fL$ Ml$IIMt$0I MtLLLuKD5H$AD$EH$?H$EH$LbH53L1HAGD@4H$H54L1Kȃ<t*;wHbHrE @IL$AAGD@tH5/L1L$̀MAt$HLHA4pA)tT1HL$L-.MD$f PЀGTHcH>UH5,L1ا]H$L`L$x=}L`L$l<1CHu L:NH$L`$L$@AGD@*H530L1I@AGD@H5x+L1!t AGD@ 1LLHL$HHL$HE% L$MD$fA@LE ;x밸 }  EI% E}  EI%EMIMI~M In}  EI%EM}  MI3MI&}  EI%EM@IMIM@IMIE lHM IW(M;C9'/% fApHA4rf tlIHAB_ MIAGD@ME   q@; H=@Hc4H>fDAGD@kH$H5+L1腢MHH*A|$bIL$MrH舦1|$DA$M\$L\$xD$PHE HD$`\$p ,HLE!LHt$H1L\$xIHl$XMl$pLd$hI<[ILI]LEMLAm*LZI@݅I@MMDp uL9l$H\uDRHZDAxwH=AHc4H>DL$PEt1@DP@%DH=&DT$pRDT$pHqMHRBA00AA B0HMDI HL zH$EEI%EA DLA-uZHrHt$PLL$H{LL$HHt$PH^HDPu.astEaIEsA%uHaLH5+LJ1AA\DLA-uZHr.u^HHt$PLL$HƺLL$HHt$P1H81H ^H0HHHHDOuH1H=%.GD.H"HMH5*LJ 1Hl$XIAL+L$`} DML$}H\$`Hӳ1HHHHD$HٳH|$HHW@/u%L$PzHT$pRHڅD$xx)HT$pz9HT$pt$xH,MoAGD@H5'L1HD$XxD$PMHڽMHڽ MHڽDT$PEH51(L1藝D$Pv\$PHl$XM܅mH57"L1LL$H`LL$HMMHڽ MHڽ MHڽ oMHڽ _L$A\$MH5!(L1HCLH5A(LJ 1˜LL軜HL$HD$HE1D\$PDLH= "LL$XSH]襱H=!HuD\$PLL$XT$`LL$XD\$PiD\$PLL$X1H8T$`1H SH0HHHHDOuHH=.thH؋L$HtlxlHPHX< H HH< eAVsHCHDw1H HD0HcH4JHHLH)BDGuHw HEHfDD\$PLL$XDH5%L1HLHEHHH5%LH1輚C<k@uH0H=@L@PH͕LHH81茴H5?1艱fH^H5cL1LD$PHL$HLD$PHL$HAHA $Hf1H=@HQHL$hH11LxnHDŽ$AGD@~HT$`H5L1蛙cfDFHDG011H H0HHHLHDOuHH= @MAD$IH;D$rH|$\$LDd$XL|$PHH|$HH4HHt$0HHD$ HT$ HHD$H|$HfH(D$L7L膢LH{H|$HtfHD$LLl$`D$hMthLH|$(誼HD$(~H|$E1H|$0KfXH|$L/fDd$XL|$PD$LAWIAVAUATIUSHT$ dH%(H$10 HM1LLAIHUE11ɺLH5蜥HHt$ HHD$LL$ H|$PHMH}ELL$HT$PH|$HEHzH;D$PLL$RLLL$}eLL$L;H#LkAD$D@T$ LLHHuEfDHHEHHEHnHE HAHE(E1O,IEHIVMu5HhHMIHM(HHIM HAIM LhHH IE fDH@HU |$ HM,HHIU HBIU LhHP IE 1H$dH+%(?H[]A\A]A^A_@fHHH$dH+%(HLL[]A\A]A^A_駾L-=1ҿ1LH-EI<$ H+I<$@L1蹢I|$ HI|$@fDLH5L1脉LHM1@ =Q1@ Ѓ$H_B{ %LD$PLHHH@HHL9t!AL1LH{1d]H1AH}qAADAADˈ܉AAD Au(O IO ILH} I @ Hb DLE,1D9;T(HDHRHHL=f;w HHP HHP HPHHPHI9P fAAEAADDÈADL$AE A ՋPDh AADAADÈADAE D ӋP\$ʉPPXAAA7PʉPPʉPGfHxXH@HHEM1PA1"Lb[XZLH 1L1B[AuH_B{ %LD$PLHHH@HHI9HAHEy}(HH<HHcHHHJ/HHHH9^IIImt KctLyHMDd${HD$0HH"AUHAED[SHT$ Ll$HD$8HHcHHAL$ItHL$HcHQH9Ht$LLLD$HH,tHD$LD$=`HWHA׉DDA A IcE߅-H(1[]A\A]A^A_@oI>IFIFIFtIH([]A\A]A^A_f.oIF1IFIFttIIHIL‹G8LD$HDLL$L9vH:t DHLLf.AWAVAUATUHSHHNHc^0H|$ HHt$(HHT$0HHD$HD$HL|$Ll$LLHHHD$H}OsHEHRLtIH^MCHD$H$IHPIMHHEE1HD$8HD$(HHcHHDHsH|$ LHHL$H9D$H|$t3LLHLHH}HHHHVI9uHT$0&^HHc=u(A։DDA A IcH$H$H9T$tDLl$H|$8'H}CrL;r6mHH[]A\A]A^A_=tL rHH1[]A\A]A^A_H}t1HHUHHHHLL$~iHHHHHHxD@|HxAF8I9s&I?t HLLL[]A\A]A^A_ @HLLH[]A\A]A^A_fAAAH[]A\A]A^A_ff.AWAVAUATUSHH|$HL$(LD$HLL$8?H|$HHwH *HAH9HwH)H9=UWD u0D1DDADAD AA=DL L9-LH)H9Yu 1Љ L|$(DT$PD\$0LL$M/*MHD$8ALt$ L MI*K4dLHPhHH|$8LL$ID\$0DT$PL'H|$HHH RLHHHD$HD$HLt)M9HD$HPL9:HxLH)HH9#SLL$0LL$1HI4H9IQH)H9=UEDDAHL$0HHL)H9Ht$LL<[HIH)ADHT$LwH|$EFL$1H|$DEu9T$XDDDDADAE A Dd$XEEIMHLAu,%Gw"H+HcH>DD$EfFHH9\$ I IQDT$uHD$0IL)HvI$HVHVH뭐L$uHD$0IL)HvA$F FHtIfHD$H|$HL$ILD$ T$\Jt8fDI9IL9*=SHD$Du-AADAADAAD ‰AML9ILfAAAHHHD$HD$L$L9]T$\D$sAA)f.AʉD҈DA A H|$Dv0EAˉDڈDA A D:HD$(L(aHLfHD$(HHD$HHHD$8HHĈ[]A\A]A^A_t$DD@DщDD ։t$DA:DKaHHD$(L(UDHD$0IL)HA$fFfFHfHD$(Ht$8LL$hDT$dH8HD$D\$`HL$PH)HD$HLHD$H=*H4@HbHL$PD\$`HDT$dLL$hpH|$(Ht$HH|$8HD$H7HD$DH\$(E1H;HeHD$8HH0`HHHL$pHHH8HH0HHHH%H HHH!HH HHH!HH H HHH!HH(H H8H0H!H HH!H HD$pHL$xщՉ ‰T$x|$~@׉fT$~D1hHD$(H8fcHD$8E1HHD$(H^H^HfDATUHLdH%(HD$1HGHGHoIeH0[IAHIс=NIHzfABfBABfBAoBBcABH$AAII$AR,ILHLHT$dH+%(H]A\1҈ʈ1fAARΈȈfAAAR1ΈȈfAAAoJAIAR1H$ȉ AA1II$AJ,Љ D]F^fDAWIH։AVIAUE1ATUSH8IoIo QMIHՉDHH9rIu @fuLMuH8[]A\A]A^A_IHt$LHLHHHT$ubHt$HT$HHD$(HtHD$(1LHL;^IIM HBH9Ll$LE11H\$D=vL7@E1HfDH;|$'LHJHLHLH9H LBHHfHLAfI9yJHZH\$HNH9XLBL@LF0f _DVfAH\$AfDLL9AAHT$ HL$E1Ll$H\$DBYfBTXIM9uLl$HT$ H\$E1IHfBLPHH;|$HD$(L1H8[]A\A]A^A_ADfAI9nDjDDhADDDADEAAE D EAHJDFHL$H9LBHL$IML@I8DMI0LMˆIHAHL MIL!IAL MIL!IEI L MIL!EI(L ILI8IHI0L!L IL!L H\$If.H\$EfDJCH9rfE FLE1D1fHD$(L1RE1@@HBPBPB PB PB PB PB PBPDJ1DB HמvYHHÐL38A1fHHt.EIA9uHH7HLH1Y@H!Ԟ1 Yf.AWAVAUIHHBzՔHATIHHUSH,2H?HHH)HHHH?H*HH)HHHH?H<H*HH)HHHH?HH)HRHHH)AHHLLE1LZӞHIH؉IHH?HHH)HHH)LH)1WAIcL9rHD[]A\A]A^A_fDHLI< IHH)ΉH?HHH)HHH)HҞH)1WAfLHҞL1|WHcIL9}LH)LLvҞD1LLD$KWAIcL9LLLD$H)LfH1HuDHH9tDJH<fEuH<0HH6IH9H7HVDHAƒHAL9sbAEyR1EtFALN1ELN\@HtHHH L9uKH)H9rHI9rfDfHt[H<uBHtD"HHDDBDH9v<x@f.ATIUHSHHHSpHhdH%(HD$1HH$HIDLtWƒtKME C8H$H$ftHL9w*HHKQH$HT$dH+%(uH[]A\øU@AWAVAUATUHSHHLohHWpdH%(H$1Ht$HD$LAAƃA$-DH4L|$ H H4LYED+LTHLHH$SH$HӅEEIH]&=-HLELl$EHAHLMDH'ҞL1SEDCHLV:;x'1H$dH+%(aHĸ[]A\A]A^A_fL|$ Dᾀ1HzΞLH ^SEDHMMH9SHWўH ҞH81XXZfDcfDD $YH8DG7D $E1H%ўH YҞfKHHLDCEHDGuAD$DEDL9O1f{HLWEE1HОEmMDIM9VC<$H}wCL%1H)LRHJОA vAE HEMH5ўEEAMLPAE PAE PAEPAEPAEPAEPAEPAEP1QHPfHA8IMH ОHϞH81VH8DL$ L$H81VDL$ L$Qf.@AWIHAVAUATUHSHHtHHt|D$E11L=aӞL:ӞAL-MԞAH„xaHA|EEHtHuHFHEHHH9w1ED$?[]A\A]A^A_f@HAAAEKA~@A~5IuI~HLD$0LD$0H$H=ΞHHD$H͞HH;l$HT$XdH+%(Hh[]A\A]A^A_HEIA>+u|A~/uuA~vunAV9wdHHsTHtHH$H5̞H0HD$H5̞H0H;l$`H|$H$Q$KfDH$H.͞HHD$H̞HHUHLLLD$0rLD$0~'H$H=̞H5t̞H8HD$H0ALM<A~A~A~HD$0IIEMV1HIDHD$8NHHH HH HH LHH;IDH=Hw A<IL9T$8t9|$0L_A IA>Eu 닉ƒwA<tH}H HqH3Iɍ(w(H$H=ɞH8HD$H=ȞH8H$H=ɞH8HD$H=ȞH8A~1A~&HD$0I.H$H=ȞH8HD$H=;ȞH8ESH$H=ɞH8HD$H=ȞH8PLMA/H$H=&ȞH8HD$H=.ȞH8HE1I&Ht$L? LL* GH$HǞH5ǞHHD$H0$qK$H$H5jǞH0HD$H5pǞH0DUHSHuu91H[]f1H5˞B t>t1H5˞H' t#H1H5 H[]øAWAVAUATUSH_DHIHHILIADžtOE8EELLHE1HH5˞1AAHD[]A\A]A^A_AANA uHAH1H5ʞH(gAN2fȉށ%=vf==xEHHH]ОHEH5ʞ1HAfD=tA= tEDFEHОHHDH5ɞfDEDftDE1EEtCLHHɞ01Aw@EDNEuE[1H5ΞHAfDA0DLHeH1A< gAHߞ1H5ȞHYtAN;1HߞH5ȞH0oANAHΞAH ɞ1H12f.AH{ΞfEH@ߞHUΞHEH5mȞI~0UEHޞHΞHEH5gȞ@HHȞH HǞHfHǞHmIHǞH,@AWAVAUATUSHH)]tIIIIHE1HfDCHDDC]t DBuI/A~5E1MtLHǞLL1AHD[]A\A]A^A_@AHHt$SHHPHH9HFHD[@Hff.AWAVAUATIUHSH[ǞHdH%(HD$1H$I<%DzLrL4$A%tyLrL4$E>IAHAHuA*LHƞLHtL4$E>A.tnYGIAIDAAFIVH$W1HT$dH+%(H[]A\A]A^A_f.L4$f.IvLH^ƞHH4$Lt&L4$E>dHtHƞLH1)@rHtAHƞL1H@Kc@HHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$$HD$HD$ D$0HD$GHu HE1tHD$dH+%(uH?AVIHAUATIUHSH dH%(H$1H\$HPLHL1A=H](IH=L$HLH=wsHM Ht/H`˞1H|$1?H<$IBH} BLD$LE Le(H$dH+%(H D[]A\A]A^DH<$HtbBH} YBHE ILHE(HTŞ1H1A H} BHE ILHE(HÞ3>GHt1{ff.HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$$HD$HD$ HD$1D$0GHuHHT$dH+%(uHS=AVIAUIATUSHMupHC Ht8uJCHuLLHv~kBH5xHH1k@KH[]A\A]A^H5ƞH1DH M|@LH1HC H5jžHC([HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$$HD$HD$ D$0HD$GHuLGXHH1HD$dH+%(uH;ff.ATIUHHj:LHHl0H1]A\-ff.fUH3:HHR]01ff.@UH:HH0]01ff.@H51ff.HGDt^t(HHοHHDH51t%H1H5u۸Hu%t1H5fuff.@AWIAVAUMATAUHSLHdH%(H$1HHD$HD$HD$HtH1HT$8DDd$Lt$ MHLDL议D$@E`MtzIEDE1 1E1 @(u@DoEu.L=1LHA0ÅLm Mt+L9HvMlH5L:uAEEDt'HT$1H5[ǞH1|H} 7H}0HE HE(Ht 7HE0eH1E@]1Hs1P]fAVAUATUSGH Lg IGEMLX3IH>N4I}0Lg4IHI] IE0+@tn69HA,$+I@tSH @HDA@uA$\CI0AD$C0AD$C0AD$+@uA$Me0[L]A\A]A^[1LLE10HX1"E1[]LA\A]A^,1LH1L01@ATUHSHH;]r'NHMHIHtFH>3HH}Ht?HDHEDHED 1[]A\H6H0LHH01XŐHG(AVAUIATUHSHHHdH%(HD$1H$W1HHI1HH6IE@u mMu*HT$dH+%(H[]A\A]A^@L0Hx IH5LLHHLeH}HEHET3BD%Lc L0HLIHHD$1LPI0IXZE@umuH54M:IT$H{ It$2HS ID$AD$@uA,$uL3$DH30fD1GHuDSH5Ht,HS HC HHS(HC(HPS8C8P[ff.@ATUHHLGHu)Lg LG HFHG(FG8H;3HL]A\LE1%3H3HL]A\fAWAVAULlATUJ,SHHt$H9L9IEH\$IIH$ff 5IAI0DF@uXH;$sb\AHI0CAG0CAG0CL9s&L9v!E7EtAD$EtD3HIL9rHD$H[]A\A]A^A_H\$@HHFHNHPHFLNPHF LFPHF PHF PHF PHF H5 P11 HHHBPBPB PB PB PB PB PBPDJ1DB HF-HHÐ1Ҿ1>-ff.ATI3H DIA$DQ utDLHH8u@DA tfBHDA uLBA\IT$LfDATE1SHt_DIAAtE1HD[A\fDHIHHH9sE111fD H9VHHB"t,uH@H9/E1ɀ8"HPEuHH9vHx"uAH9wHE1IAA!E>%=,H M1LH5ȳLADHH MuHI1f.I91EuH9v>:"tHfHH9:"HBt E1fHIE1HAA!1H5L +/IE1I9AA!LiƞLHAH9s! HB"\tt HH9rHE1HD@H9tDBHBAuwA[vnAHMIAADuAuuHH)H~wHDHDA0A vFwK@vfDH9uufDAHDA"UA/VFa>H4fAWIAVAUIATIUHSH(HdH%(HD$1H9sH&< wHrGH9tKIHCHD$"t<[ H ѱHcH>@HH9uI$E1H|$HKHT$AEDH9vH&< w HHT$I$Mu5Et-H9$8uH|$LH0E1HD$dH+%(H(D[]A\A]A^A_H\$ -/HH9z0E1 wHH98 A0 vH99<.IH9v/0 wHH9~A0 vH9E)HD$H9H}PHD$"H|$HHT$H9v< w IH9HBHD$::uCIMLHHT$H9HBHD$,8}HD$HE1`HD$H9H9vH& wHruHD$H9tx8]*LIMH|$H>HT$tUH9tP<,<]uAHIG(LAHT$f.HHH9pHHT$E1LCLL9LD$H ǭ"fI98qHH9H9wfDHSH9HT$H }LA!L98qHH9`H9wfDHH9fDHH9ffDHH9HKHD$IOHAHl$HHl$HEHl$HI(AE1IAEHJH9(BpՁ HJH9B0HE1 w$HH9=A0 vfDHT$. E1HJH9BH@E1I(AE1IAHl$AI HBHD$H9HfDH9s;KHH9I $mHD$AHHAI$M42H"AUSHX_DHdH%(HD$HHHD$t"1HT$HdH+%(HX[]DLD$fH1H4H|$L)D$)D$ )D$0Ztt@uLHHUHEH5^1HugVfDH HHEH5ҧ!DHH=Hu#1ʉ Ѓt AAADADfDAUATUSHD_DdH%(HD$1EAt*E1HD$dH+%(<HD[]A\A]DHHH,$H~IHHE1E1ɉH$H…uuII A(H)L9vMmAAt,H5ϩEtH5L1A91A&DHHH)H$H~Sf9H$IHHH)H~/BLL 4+H$I=fDI.f.AWAVAUATUSHoDHLdI1LL HHt IGH9~X%MILMIIL9dA$HL)HADP uHbL1DI L9tA$PЀvf.I1HH9uL H)H9u19IH5ML4 AEtH59L t4HuH HHH1H5LtH[]A\A]A^A_1H[]A\A]A^A_H/gpkg-11H9JlپAD@ D1AWAVIAUIATUHSHHdH%(H$81L|$LHH6OHH "IH0LLHtCL HSH$8dH+%(HH[]A\A]A^A_f.{MMH ˆT$t%E11ɺLH5@s IHH$Ly EE{fo$LLfo$fo$Hfo$)D$fo$fo$)L$ fo$fo$)T$0fo$ )\$@)d$P)l$`)t$p)$)$U IHIMLLHxHHH@yH)1HLHtjL,|$fLT1H5H.DL1.3LHܥH1L|$t Ln13LHH1jL\$(u1H50HaLt2H5 H1ML1[1H5ޤH-u.ff.GBHtAfff.@Ht1f.Ht mHt MHt -Ht11fD1DHt11ff.fHHt 1D1DHtWATIUHSHt+111MIHwt[H]A\&fD[1]A\f1ff.fHnHt 1GHtHG HtGHt G@fHtGDøff.fHtwD1øff."fDHH HHcH>@H(1fDf1fDffDf 1fDf1fDf 1fDf1fDf1fDH1fDH 1HHøH HщH6HcH>@H(H1H1H H1H1 H1H1H1HH1H H1H Hø@HHHdH%(HD$1HH$x H $HHD$dH+%(uHfDHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0HD$dH+%(uHfDHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0EHD$dH+%(uHXATIH1UHHSEHLHԟH1HL]A\ÐAUATIUSHHXdH%(HD$H1HT$Hχ:H9M|H|$Ht$5HHt-HIHtH5HADfDLH5(HIHD$HdH+%(uOHXL[]A\A]DH|$Ht$$Hz@HH|$KHT$HT$0AUfIATIHHdH%(HD$81)$H)D$D$ f fP)D$ HD$0҃T$H[D$Ht HD$8dH+%(u$HHLA\A]@LH50LOff.@AUfIATIHHdH%(HD$81D$HD$D$($f f҃?T$HĝD$ Ht%HD$8dH+%(u)HHLA\A]fLH5LNAVAAUIATIUHSHdH%(HD$1DHHHH$:ut9LH5"LHD$dH+%(u4HL[]A\A]A^HH1LLyyff.ATHUSHHW DGdH%(H$1DHtH H-HRPH1H}|CZL%|YtdSH SL9H}Hp1@C@DCH}H% H;1 CKLL9sHH LѨH}H6H cHDH1C @4CHuƒtR<;wHbHr>C H<gHKHt8H}H1WDCKH}KH}1Ha{xtSs@;@v'$H\HcH>@ wR@H}1HH H$dH+%(H[]A\ÐH AS HH}H1H]3lfDH੐ tiK H}HN18f.@uH}H+1 DHHH ^D@`@uSH}Hs N=fHu~bDH1U/6C[3  @uvuYu<uHuJ Hul CDHuL CDHuh CDHuHj CtfHuBR CWf.Hub2 C/f.Hut Cf.Hus Cf.HuC Cf.Huc Cf.Huw Cgf.HuWr C?f.Hu~R C%f ZS H1HK H}1H_NS Hf.S Hf.HS hHS H1[fH}HK 1HxHS H(C H}HY@fZC DH{ 1I2;LHH1 HuL FIHS LHuL HHS HuHV f.fAUIATUHSH[ HHImIHuJfImIHt;H+ HHLHHHH HtMm@E1L HL[]A\A]ff.@AWfAVIAUATUHSHWDdH%(H$1)D$@tBHt=HyP HD$Mu31fDfDMYHD$I1Ld$PL-DA@LHAGGw?IcTL>fEDugAOLH51HuIfH$dH+%(HĨ[]A\A]A^A_fEDHII9WEDH|$tHT$1H5HSuDAO~IW1Hc@HHHD$H911H\$HHl$(HLt$0ILd$8AL|$ JfD IAMAD@@t D,HIL9t$HzAr E>EuHH\$L|$ Hl$(Lt$0Ld$8Ƅ<ED$1H$LHH58_f.EDfAZG@IWHcHƤ~H9H$@HHL$fEDHL$$1LH5qHHII9^EDAOLH5xEDAGLH5H6]HII9AOLH5DHFH9AXMefDH|$@HH|${H|$H$,HHt HHD$HL$HtEDHII9?fH|$A?H$H5HD$@HH\$L|$ Hl$(Lt$0Ld$8H~1#11cMtHgHD$VHMHD$<DAWAVIAUATUSHH$H$Ht$(HHT$HT$`L$HL$0HL$PH$LD$8LL$@HD$H|$ dH%(H$1HD$XIHD$H'AFD,HT$XHt$PLLH|$PAlj$A<$<$Lt$L|$E1E1H$@M9gI/E1LDB|u}B3II uHD$H5H@DHHDIIňHtLt$AVDtHH51L$H$dH+%($Hĸ[]A\A]A^A_1H5Lf|$`HLHH56HE1D$dL$fADfAEf3f;DDH5:1LCtNM5I|$P &HFI9D$X1HH5L$HHLt$AFDttHHH5ۆu4$Ht$ PLL$ LD$PHL$HHT$@Ht$(H|$8aZYt-AFDtoP1H5ÎLF6$1DDH5.1DLH52 f.1H5FLtHT$HHt$ H|$薡tH|$XHHL(AH$L%H-lH|$XIIHL9vbHAwLHL9H HDH $̧H $LLH18$uH|$X!$, fDAWAVAUATUSHuHHdH%(H$1HH\$ HDŽ$L$`HT$hHD$pGDt9E1H$dH+%(HD[]A\A]A^A_f.L$Ld$`HLL腃tLt$0LLLTL|$@LLLL.H\$PLLLH词fLL$(HLLH$LIHD$PILLLH$LHD$PHPLD$xAXAYtSH$H$Hv2H$Hment FilHHWP DocuH3AH3H u ye.H|$,HLLIt$LD$LL軓^_8t H"HD$ HLLIt$LD$LL虒ZYG8t HHD$ L-ݞH5@E1ME1HuHIKtH/CT8H葐~݋EDH|$6H|$,H|$PH|$@H|$0,@H|$0HŠHD$ EDt(A?DHHD$ f1H5wH诽t HT$ :t1H5,H菽uAH|$@HJHD$ :H|$00i1H5HG^@HHD$ H|$PH|$@H|$0fHD$ MLLPLHt$0t$ SLL$(8D$fffA DE1@tfDff}1fAfA Df A f1A fA f)A ft!1fAfA vf!A jAiff.@HVF HHt0H5AHcH>fA E1@tDtg1AA D A 1A A )A t1AA !A Aff.fHHvHt4Q LHIcL>f1HHA @tH1@H H7H1H7HH7H)HHH71HHH!H7ff.HIATHH9w5IH9w)vMtPHH6HcH>fDgDAuFADA\f.HHIHD@t HѸH96E1A DA\fHܞHH81cDA\DDgDAtHoܞHlH811l@LD@t{fDL)IfL L1HHIH@L!ff.AWAVEAUIATUHSHHFD~ EuAH1ҾLLDjD}8E<EDu"H[]A\A]A^A_fG2DH9sjH)H9HFLƉуq>A:tfAt f1D΃I0HH9IzI1HIBxI)AHH1[]A\A]A^A_HI H|I| IzLHH)H)HHwH)L҃s'wtt1fLfHzHHD HH) 1HSDΉH9HGI,0H)IwxIohIGp(@H\$XSJ~uDH9H)H9HFIу AAADfAD fDMDH9H|$XDgGMKH)H~AI4Ht$H9HGHI,H9HELt$H$4fH9$v > MLpIL9~I LM)LHuL LsHuHD$I_xILJH)IGhIopf.IGpIGhIzDIBHIBx)1HDIVfLLH9MB'HrH9v zt HHI9vaH9v\2@1@uùzu@>A:tAt (Dx HH9$HABH)M11L9IGIHfDMHIIzLHIILILLH)H)HvDDAI<H|$H9HFHLLIPAAADAD AWDIAVAUIATIUSH(DD$u=E1AA H)HHuI9u1H([]A\A]A^A_L4MM9D$ƃt$ ƃD$t$@I@IDBttIHHLHlLEL  ff.G%wHA~HcH>D+f,f.%f.&f."f.#f.f. f.f.f.f.f.f.f. f.f.f. f. f. f.UAHSH1HHΞH;H;HRH3 uH3H []bfAV%AUE1ATIUSXH1H~%[-0-9\HHHHEHEHE HME .]*sE$~E%"HHtju1HIIHtPLHH1LSHE1MLE1ZLYAE@t[D]A\A]A^AE@umuH[D]A\A]A^f.AVLAULATIUHH(dH%(H$1L$L*AL$MD;T vA<.DH{HcH>w+# H7|HcH>fH@ txHL'LI 2AD$DLd$HsL1LLH1[eHLLItcAD${ALd$z1fDH$dH+%(JH(]A\A]A^HH賩fAD$<=@@(HfH*1\ø@uRHfH*f.zt1^DHfH*Y1Hx[fH*X1HЃfHH H*XJfHЃfHH H*XZfHЃfHH H*XDHЃfHH H*XLÐ1HtE@txw>@@(HfH*1\ø@uRHfH*.}zt1^fDHfH*Y1Hx[fH*X1HЃfHH H*XJfHЃfHH H*XZfHЃfHH H*XDHЃfHH H*XLÐATAA%A?A ĉA A u DA\DHÞDHxH81`DA\f.AVAUATUHHSNLÀ;w>II vK 0w+H5rHcH>E1D#[]A\A]A^@v#HPttEf8AIcJuDg8AIc1fDttJuIcV8IfDg8AIcH9w[]A\A]A^fDEEf8AIcAE<=_HPLH AWIŀ>w( B<H QqHcH>^xDeDAXAHT$XdH+%( HhD[]A\A]A^A_ÀucKuAWEGI 1HXHH@H5 xH1诜AJ@HE1L!H9AED,HIILATL5HHPu@FN <='<>yY1EDAGwE1L9AąSL5~EILH>s1I>7fHE1L!H9AED HIILATL5(HsI>1XZE1L9AEDL5EILHgr1I>T@EDAGWE1I9AąsL5EILHMr1I>WEDH~rH1 cAăEDfE1DHI 19HcaE1HA@FvI ҃HI|HH]pLuhH$D$8H{ D$HHLHLt$@IHIEI}IEI]HT$0LLHADAE1jH|$AUY^@u$AmuL&IfH|$0|$H~H|$@1HHhx^H81IHHH;H2A}t x!HHUh1HHExIEH@HLH$dAL$H$@u&A,$uULkH$1yfHGhH$HFDE1AGE11Mg D$ HD$6fDL)EGLLHH$HJ40HHHdI|$ t L9t$eHEpK.H9s1@E1L9AąL5GEILHn1I>E1I9AąL5EILHn1I>kL5ٸH1H@nI>CE1.ȸADEnE1.AWE1f.ADE=E1f.A&AEGEgH]pAGH\$(Hڅt LH9HFHIL9H$Iw HHv IMeL$L)CD' D$ I9dIEEw HD$IG!HD$ L9?HDLL)HIHL@D$ C:D%uHT$H|$ LLD$LD$ufDHD$(LH+ $1HMx1H)HDH1LuxfDE1f.ADEE1.ȸADESLH$1@H$'HH=lHguAw H<$IMHEhH$HEpHD$(H<$LHsILfAT$@A,$Lt>pAT$@A,$~Lt@Ab^XAff.@AWIAVIAUMATIUSHXH$HT$DL$H$HD$HH$H$HD$PH$HD$0H$HD$8H$HD$dH%(H$H1AGDD$xD$|% HD$dHD$|HEHLHD$(HD$xHE1HD$ \H|$H$11HD$@LMMIHIH,HLE<-t*<;wH BHE|$!9HT$@E1MLHLpEHMLHLIEXt$(t$8t$0t$Xt$X$$$P$PD$dPjL$H$xrH`m})HLWHD$HLD$`btHD$ D$dMELHLH$ L趚MCH;D$oALd$XMEH@SH,HHl$Xf}3EID$XED9`A9HT$@MLDGHLEnEtEAEHID$AD$8E <wDHID$xHMLHt$(Lt$8t$0t$Xt$X$$$P$PD$dPAUL$H$xH` }!vID$EIBDEM9WLL)HGHH|$\HDHHT$hMHHDt$hEtDCDD$Ep$Dt$hWHHSD2Dt$h{UUE1AULD$ LHAXAYAǃDs8CDtDLBHf.M;#v&A<HX]HcH> w[D$hL9$AHUE H H V]HcH>DHHH )D$DuKSfDHPMt^D$hL9wmI)Ivd@$DD"H\HcH>DuD$hL9vfDE1H$hdH+%( HxD[]A\A]A^A_ÐH$MEHbPHD$ PH]AUt$ DEH81 DH LAH@$EK4Ht$tǃ;H?\HcH>D$hL9#I)ImD$hL9I)I$DD@CD ADDd$hEt Dd$Dd$hEEM9HHD$HXHD$M)HDŽ$PHDŽ$XfHD$0ooPo` op0)$o@@)$oPP)$o``)$opp)$o)$o)$oHD$)$0L)$@H$8L$@)$)$ )T$0HLpL9W Dd$L|$(L$Hl$0L$$HLLt$H H[H9]tCHHSE1LjA Hjt$8AWAVATt$Pj$PH3 HPtHDd$Hl$0AL[6CD Ht$H褐IH A LD$hL9I)I$DFfDDd$hMM9w} ^Lm u$1Lm!$HT$pLH4(AǃpLH\1H12 D+AHYHcH>DHIut"HLwf$HHHfDuD$hL9nfDH[CDUHH81:f.CD&HL[   ЉHLH5[H1E1蘁fHLfUI)L9{ƃAifDȉmD1HH5/LH_ADDH5ZH1܀E1HHHHUu LȉHUu L'fM9LL)HwH΃(tAHc|$\HE+M9GLL)H7Ή'u{D@B1L9 MLL)HHc|$\HDICD:HLHXH81FHHIHLHH#HL)H9HGHt$K,1 HH9uIA$AB1L9MLL)HV V V M9LUL)H91L覺IB1L9qMM9eH|$\HDImy򈣈fDE @^AA򈃈̉0(HCLkIHD$ILHCHHLL葺HD$(8|$\EtH<$D$lHHD$tfk.d, song "%.32s">Ne, game "%.32s" =l@PJL ENTER LANGUAGE=FWUPDATE2HP Printer firmware updateful2 =*old timezone data =)old timezone data =(old timezone data ='old timezone data =&old timezone data =%old timezone data =OTue Jan 22 14:32:44 MET 1991Erlang JAM file - version 4.2 =Tue Jan 22 14:32:44 MET 1991Erlang JAM file - version 4.2 =wStart/Stop parameter header:Caris ASCII project summary =CInno Setup Uninstall Log (b)InnoSetup Logapplication/x-innosetupdat>H%.7sxJ%s=@M{magic/windowsx@N%-.38sx @P, version %#xx HT, %u bytes< @Ymagic/windowsx [, %sx ]\%sx _, "%s"> @amagic/windowsxc, %-.9s=e+magic/windowsxg\%-.9s=h+magic/windowsxj, %-.42s = @CorelBMF Corel CorporationCorel GALLERY Clipartimage/x-corel-bmfbmf =,
Stata Data File=-[0-9]+(Release %s) =:%!PS-Adobe-3.0 Resource-FontPostScript Type 1 font text =1002003old ACE/gr binary file>'- version %c =aspell default speller rowlaspell dictionaryapplication/x-aspell-dictionaryrwsx, version %s= @Na, little endian=@Na, big endianx@, old =$SVN-fs-dump-format-version:Subversion dumpfile>%(version: %s) =;Gamebryo KFM File Version Gamebryo game engine animation File= [0-9a-z.]+, version %s = -----BEGIN PRIVATE KEY-----OpenSSH private key (no password)text/x-ssh-private-keykey = -----BEGIN CERTIFICATE-----PEM certificateapplication/x-pem-file =(*^ ::[ frontEndVersion =magic/mathematica=.wolframmagic/mathematica@="@#! /usr/bin/env runhaskellHaskell script executable =8sk-ssh-ed25519@openssh.comOpenSSH U2F ED25519 public keytext/x-ssh-public-keypub =Warcraft III recorded game%s =Identification_InformationFGDC ASCII metadata =-----BEGIN PUBLIC KEY-----OpenSSH public keytext/x-ssh-public-keypub = -----BEGIN CERTIFICATE REQPEM certificate requestapplication/x-pem-file =*# Bazaar revision bundle vBazaar Bundle@="@#! /usr/bin/env execlinebexecline script text executabletext/x-execline = # This is a shell archiveshell archive textapplication/octet-stream = #! /usr/local/bin/clojureClojure script text executabletext/x-clojure =?nut/multimedia containerNUT multimedia container =Paint Shop Pro Image FilePaint Shop Pro Image File =hAVG7_ANTIVIRUS_VAULT_FILEAVG 7 Antivirus vault file data =,-----BEGIN PGP SIGNATURE-PGP signatureapplication/pgp-signatureasc= 0d magic/pgp=.1pgpmagic/pgp =# ACE/gr fit description ACE/gr fit description file =#Windows Registry Editor magic/windows=$Version 5.00 Windows Registry text (Win2K or above)text/x-ms-regeditreg =`Ph`P@@@@@@@@Linux S390=@ magic/linux=hZ10 64bit kernel=Z9-109 64bit kernel= Z990 64bit kernel=Z900 64bit kernel=ȀZ10 32bit kernel=ȀZ9-109 32bit kernel= Z990 32bit kernel=Z900 32bit kernel =@ࡱAAFB OM+4AAF legacy file using MS Structured Storage= (512B sectors)= (4kB sectors) =@ࡱ +4AAF file using MS Structured Storage= (512B sectors)= (4kB sectors) =bsjb pdb v1.0Microsoft Roslyn C# debugging symbols version 1.0 =wPOLY SAMPLE FILEversion Biosig/TMS32biosig/tms32 =DOS Client Message File:Novell DOS client messagemsg> magic/msdos! %c! %c! %c! %c! %c! %c! %c !  %c !! %c !" %c !# %c !$ %c=, Tranmagic/msdosx, tran version %s! , terminated by %#2.2xx%2.2x!e, at 0x65 %#x!f, at 0x66 %#x =C ACTApricotdiskimagefloppy image data (ApriDisk) =5 East_Side_InvertationaQuake I save: ddm4 East side invertationa =-----BEGIN ECDSA PRIVATEPEM ECDSA private keyapplication/x-pem-file =O(***********************Mathematica 3.0 notebook =# abook addressbook fileabook address bookapplication/x-abook-addressbook = BDNetscape Address book =; -: 0:Source:magic/coverage=< -: 0:Graph:magic/coverage== -: 0:Data:GCOV coverage report =PRG formatted GEOS fileFormatted GEOS file=, APPLICATION=, AUTO_EXEC=, DESK_ACC=, ASSEMBLY= , DISK_DEVICE= , PRINTER=, SYSTEM =C~from '%s' =XB@#! /usr/local/bin/bashBourne-Again shell script executable (binary data)text/x-shellscript =?@Bochs Virtual HD ImageBochs disk image,x @type %s,x0Asubtype %s =#!/usr/bin/env clojureClojure script text executabletext/x-clojure =+age-encryption.org/v1 age encrypted file=,^[^ ]+, %s recipient=-scryptmagic/crypto=.@[0-9]+$(N=2**%s)=/ -> , among others =SWriteNow@Maple worksheet, but weird =~Winamp EQ library file%sx%.4s =3WINE REGISTRY Version WINE registry textx5, version %stext/x-wine-extension-regreg =GF1PATCH110ID#000002GUS patch =GF1PATCH100ID#000002Old GUS patch =TGALILEO EEG TRACE FILEBiosig/Galileo biosig/galileo = @O, hot keyx@Q%c=AS+SHIFT=AT+CONTROL=AU+ALT= ]magic/windowsx L_, IDListSize %#4.4x=.Nalnk-itemmagic/windows > NNcmagic/windows=. NNdlnk-itemmagic/windows> fmagic/windows=.glnk-itemmagic/windows> imagic/windows=.jlnk-itemmagic/windows= lmagic/windows= nmagic/windows=.Lolnk-infomagic/windows= qmagic/windows> Lrmagic/windows x LNtmagic/windowsxvmagic/windowsx x, LocalBasePath "%s" =Extended Instrument:Fast Tracker II Instrument =EXTENDED CPC DSK FilAmstrad/Spectrum Extended .DSK data =DIGI Booster module%s>%c>%c>%c>%c>b, "%s" =H %c>!.%.2s>#.%.2s) =# CAR archive headerSAPCAR archive data@2=+`f- version %d>g.%d =Client UrlCache MMFInternet Explorer cache file> version %s =ALPHA-TRACE-MEDICALBiosig/alpha trace biosig/alpha =>5 the_Sewage_SystemQuake I save: e4m1 The sewage system =C5 the_Nameless_CityQuake I save: e4m8 The nameless city (secret) =;5 the_Haunted_HallsQuake I save: e3m7 The haunted halls (secret) =+5 the_Grisly_GrottoQuake I save: e1m4 The grisly grotto =45 the_Ebon_FortressQuake I save: e2m4 The ebon fortress =X5 Research_FacilityQuake I save: hip1m4 Research facility =0123456789012345BZhEXP1 archive data =#!/usr/bin/env perlPerl script text executabletext/x-perl =! __________EMIPS archiveapplication/x-archive=Uwith MIPS Ucode members=Lwith MIPSEL members=Bwith MIPSEB members=Land an EL hash table=Band an EB hash table=X-- out of date =! ________64EAlpha archive=X-- out of date =Sharp JisakuMelodySHARP Cell-Phone ringing Melody=Ver01.00Ver. 1.00x , %d tracks =dmagic/biosig=$emagic/biosig=8jBiosig/FIFFbiosig/fiff@=+  %.3s document text=$: "%.12s"x !, NEOP%04X= (debug mode enabled) =TB@#! /usr/local/bashBourne-Again shell script executable (binary data)text/x-shellscript =#!/usr/bin/env cljClojure script text executabletext/x-clojure =[Equalizer preset]XMMS equalizer preset ="SOUND SAMPLE DATA Sample Vision file =/Imagefile version-iff image data> 1%s =#ExecROM patchfileMSX ExecROM patchfilex$v%dx%.%dx&, contains %d patches =15 the_Ogre_CitadelQuake I save: e2m2 The ogre citadel =05 the_InstallationQuake I save: e2m1 The installation =,5 Ziggurat_VertigoQuake I save: e1m8 Ziggurat vertigo (secret) =m5 The_Genetics_LabQuake I save: d11 The genetics lab (secret) =U5 Storage_FacilityQuake I save: hip1m2 Storage facility =V5 Military_ComplexQuake I save: hip1m5 Military complex (secret) =C(SYSTEM::VERSION 'CLISP byte-compiled Lisp program (pre 2004-03-27) =:# LAMMPS data fileLAMMPS data file=;written by OVITOwritten by OVITO =I# GIMP Curves FileGIMP curve filetext/x-gimp-curve/txt =+PNG  CgBImagic/images=  IHDRPNG image data (CgBI)image/pngpng=. png-ihdrmagic/images =%!PS-AdobeFont-1.magic/fontsxPostScript Type 1 font program datafont/x-postscript-pfbpfb=:magic/fonts>(%s)! :magic/fonts= "/FontName /magic/fonts= $[A-Za-z0-9-]+(%s) =JAVA PROFILE 1.0.magic/java=magic/java<1Java HPROF dump,xcreated %s =(kicad_symbol_libmagic/kicad= KiCad Symbol Librarykicad_sym=!(versionmagic/kicad=" magic/kicad=#[0-9.]+(Version %s)@=+:%)(%d frames=-, infinite repetitions)=-, %d repetition)>-, %d repetitions) =MUGICIAN/SOFTEYESMugician Module sound file =Gscreen mode id:i:Remote Desktop Protocol connectiontext/x-ms-rdprdp=L1, window mode=M2, full screen mode =minidump FreeBSD/FreeBSD kernel minidump=powerpcmagic/freebsd>for %s,> %s,=@big endian,x@version %dx@little endian,x @version %dxmagic/freebsd>for %s,=big endian,xversion %dxlittle endian,x version %d = d13:announce-listBitTorrent fileapplication/x-bittorrenttorrent =-TRSNIFF data Sniffer capture file=!.(compressed)x /- version %dx 0.%d= 1(Token Ring)= 2(Ethernet)= 3(ARCNET)= 4(StarLAN)= 5(PC Network broadband)= 6(LocalTalk)= 7(Znet)= 8(Internetwork Analyzer)= 9 (FDDI)= : (ATM) =HWP Document FileHancom HWP (Hangul Word Processor) file, version 3.0hwp =p5 Takahiro_TowersQuake I save: d2 Takahiro towers =k5 SECRET_MISSIONSQuake I save: d3b Secret missions =5 SANDRA'S_LADDERQuake I save: ddm7 Sandra's ladder =1.00 .0000.0000MSVC .wsp version 1.0000.0000 =%!PS-AdobeFont-1.PostScript Type 1 font text>(%s) =#!/usr/bin/pdmenuPdmenu configuration file text =l # ## $ for %.63s>e, directory=%.64s>, parameters=%.64s=U WINDOWS VMM 4.0magic/msdos >^magic/msdos< PIFMGR.DLL, icon=%s> PIFMGR.DLL, icon=%s >magic/msdos<Terminal, font=%.32s>Terminal, font=%.32s >magic/msdos<Lucida Console, TrueTypeFont=%.32s>Lucida Console, TrueTypeFont=%.32s=U WINDOWS NT 3.1, Windows NT-style=U CONFIG SYS 4.0 +CONFIG.SYS=U AUTOEXECBAT 4.0 +AUTOEXEC.BAT = collection.anki2Anki APKG file =SEGADISCSYSTEM Sega Mega CD disc imageapplication/x-sega-cd-rom=.sega-mega-drive-headermagic/consolex, 2352-byte sectors =SEGABOOTDISC Sega Mega CD disc imageapplication/x-sega-cd-rom=.sega-mega-drive-headermagic/consolex, 2352-byte sectors =SEGA SEGASATURN Sega Saturn disc imageapplication/x-saturn-rom=.sega-saturn-disc-headermagic/consolex(2352-byte sectors) =SEGA SEGAKATANA Sega Dreamcast disc imageapplication/x-dc-rom=.sega-dreamcast-disc-headermagic/consolex(2352-byte sectors) =  !NTITLE REMARKCNS ASCII electron density map =&%PS-AdobeFont-1.PostScript Type 1 font program datafont/x-postscript-pfbpfb>*(%s) =8MMXMAR Area Detector Image,>09Compressed(%d),>L:%d headers,>P;%d x>T<%d,>`=%d bits/pixel = $Bf$90Biosig/UNIPRObiosig/unipro =sSwath Data File:mbsystem info cache =PC Research, Incgroup 3 fax data=, normal resolution (204x98 DPI)=, fine resolution (204x196 DPI) =PC Research, IncDigifax-G3-File=, fine resolution= , normal resolution =PB@#! /usr/bin/bashBourne-Again shell script executable (binary data)text/x-shellscript =#VRML V1.0 asciiVRML 1 filemodel/vrmlwrl =zriff.(Sony Wave64 RIFF data=}waveOۊ, WAVE 64 audioaudio/x-w64=(fmt Oۊmagic/riff= , mono= , stereo> , %d channels> %d Hz =bookmarkMacOS Alias file =XPCOM TypeLib XPConnect Typelibxversion %dx.%d = XPCOM MozFASL Mozilla XUL fastload data =VoIP Startup andAculab VoIP firmwarex#format %s =StartFontMetricsASCII font metrics =SIDPLAY INFOFILESidplay info file =SEGADISCSYSTEM Sega Mega CD disc imageapplication/x-sega-cd-rom=.sega-mega-drive-headermagic/consolex, 2048-byte sectors =SEGABOOTDISC Sega Mega CD disc imageapplication/x-sega-cd-rom=.sega-mega-drive-headermagic/consolex, 2048-byte sectors =SEGA SEGASATURN Sega Saturn disc imageapplication/x-saturn-rom=.sega-saturn-disc-headermagic/consolex(2048-byte sectors) =SEGA SEGAKATANA Sega Dreamcast disc imageapplication/x-dc-rom=.sega-dreamcast-disc-headermagic/consolex(2048-byte sectors) =RF64WAVEds64MBWF/RF64 audioaudio/x-wav=(fmt magic/riff= , mono= , stereo> , %d channels> %d Hz =RAD by REALiTY!!RAD Adlib Tracker Module RAD = PaRtImAgE-VoLuMePartImage=  0.6.1file version %s> ` volume %d> type %s> device %s,>! original filename %s,= D'# not compressed= D'$ gzip compressed= D'% bzip2 compressed> D'& compressed with unknown algorithm> ' 0.6.1file version %s< ( 0.6.1file version %s =ObserverPktBuffeNetwork Instruments Observer capture file =NIST_1A 1024 NIST SPHERE file =wLinuxGuestRecordXen saved domain=x(namemagic/linuxxy(name %s) =LibvirtQemudSaveLibvirt QEMU Suspend Imagex , version %ux , XML length %u= , running= , compressed =LibvirtQemudPartLibvirt QEMU partial Suspend Image =4LAMMPS data fileLAMMPS data file= 5CGCMM stylewritten by TopoTools=6msi2lmpwritten by msi2lmp=7via write_datawritten by LAMMPS =KarmaRHD VersionKarma Data Structure Versionx %u =Interpress/XeroxXerox InterPress data=/(version>%s) =GnomeKeyring GNOME keyring= , major version 0= , minor version 0= , crypto type 0 (AES)> , crypto type %u (unknown)= , hash type 0 (MD5)>, hash type %u (unknown)=, name NULL !magic/gnome>, name too long for file's pstring type<magic/gnomex , name "%s"x, last modified %sx, created %s &magic/gnomex, locked if idle for %u seconds^, not locked if idlex, hash iterations %ux, salt %llux4, %u item(s) =7GOBJ METADATA G-IR binary databasex8, v%dx9.%dx:, %d entriesx;/%d local =A GARMIN BITMAP 01Garmin Bitmap filesrf>/J 0, version %4.4s> UL , %dxx SN %d =Extended Module:Fasttracker II module sound dataaudio/x-mod>Title: "%s" =@(#)ADF DatabaseCGNS Advanced Data Format =Xv(V.%1.1s) =# v2 git bundle Git bundle =m# ## Maple something anomalous. =k# ## magic/asf= .asf-objectmagic/asf= .asf-objectmagic/asf = BEGIN:vcalendarmagic/misctools=magic/misctools=VERSIONmagic/misctools=Q:2.0iCalendar calendar= :VFREEBUSYfile, with Free/Busy componenttext/calendar????iFBfifbx#magic/misctools=%:VALARMfile, with ALARM componenttext/calendar????iCalicsalarm/icsx,filetext/calendar????iCalicsx4vCalendar calendar filetext/x-vcalendarvcsx;vCalendar calendar file, without VERSIONtext/x-vcalendarics/vcs!C , without CRLF =mSQLite format 3magic/sql>oSQLite 3.x=D \databasemaple=DYDUAdatabaseapplication/x-audacity-project+sqlite3aup3=DDWjdatabaseapplication/vnd.sqlite3db=DQdatabaseapplication/vnd.sqlite3fossil/fsl=DQdatabaseapplication/vnd.sqlite3/fslckout=DQdatabaseapplication/vnd.sqlite3/fossil/db=D01PGdatabaseapplication/geopackage+sqlite3gpkg=DGKPGdatabaseapplication/geopackage+sqlite3gpkg=DXBPMdatabaseapplication/vnd.sqlite3mbtilesxDdatabaseapplication/vnd.sqlite3/sqlite/sqlite3/db/db3/dbe/sdb/help/ide/localstorage/sqlar/xowa/mbtiles=<NTM_(Monotone source repository)!<NTM_magic/sql=DQ(Fossil checkout)=DQ(Fossil global configuration)=DQ(Fossil repository)=DbDeB(Bentley Systems BeSQLite Database)=DnLeB(Bentley Systems Localization File)=DGKPG(OGC GeoPackage file)=D01PG(OGC GeoPackage version 1.0 file)=DirsE(Esri Spatially-Enabled Database)=DXBPM(MBTiles tileset)=D \(Maple Workbook)=DYDUA(Audacity Project)=DDWj(TeXnicard card database)xDmagic/sql!D, application id %u!<, user version %dx<(%#x)x`, last written using SQLite version %d!, page size!%u=65536!, writer version %u!, read version %u!, unused bytes %u!@, maximum payload %u! , minimum payload %u! , leaf payload %ux, file counter %ux, database pages %u! , 1st free page %u!$, free pages %ux(, cookie %#xx,, schema %u!0 , cache page size %u!4 , largest root page %ux8magic/sql=8, UTF-8=8, UTF-16 little endian=8, UTF-16 big endianx8magic/sqlx8, unknown %#x encoding!@, vacuum mode %u!H, reserved %#llxx\, version-valid-for %u =.EESchema-DOCLIBmagic/kicad=/ KiCad Symbol Library Documentation (Legacy)dcm=1Versionmagic/kicad=2 magic/kicadx3(Version %s) = ALIAS ASSIGN magic/msdos= 4DOS4DOS help file, version 2.xapplication/x-4dos-hlphlp@=$"@#! /usr/bin/zshPaul Falstad's zsh script text executabletext/x-shellscript@=B"@#! /usr/bin/awkawk script text executabletext/x-awk@=-"@#! /usr/bin/ashNeil Brown's ash script text executabletext/x-shellscript@="#!/usr/bin/nodeNode.js script executableapplication/javascript(=*7zXZXZ compressed data, checksumapplication/x-xzxz=NONE=CRC32=CRC64=  SHA-256!= **IDENTIFICATIONBecker & Hickl PMS Data Filex+(%d data blocks)sdt =: SIDMON II - THESidmon 2.0 Module sound file = version=SPECjbbSPECjbb< :%.4s<%:v%.4s raw result text =Standard Jet DBMicrosoft Access Databaseapplication/x-msaccess =Standard ACE DBMicrosoft Access Databaseapplication/x-msaccess ='IMA IKUNOUJYUKUSamsung Pico ROM imageapplication/x-sega-pico-rom=.)sega-mega-drive-headermagic/console =2@ANDROID BACKUP Android Backupapplication/x-google-abab>9, version %s=;0 , Not-Compressed=<1 , Compressed=?none , Not-Encrypted= Gustar; contains=.Htar-filemagic/android!Lnonemagic/android=&M^([^n ]|n[^o]|no[^n]|non[^e]|none.+).*, Encrypted (%s) =#VRML V2.0 utf8ISO/IEC 14772 VRML 97 filemodel/vrmlwrl =#! /usr/bin/cljClojure script text executabletext/x-clojure ==glfHeadMagic();GLF_TEXT =9_SGI_SoundTrackSGI SoundTrack project file =VIC20 CARTRIDGECommodore VIC-20 cartridge= ,! magic/c64x : "%.32s",=generic cartridge=Mega-Cart=Behr Bonz=Vic Flash Plugin=UltiMem=Final Expansion =SSH PRIVATE KEYOpenSSH RSA1 private key,>version %s =PLUS4 CARTRIDGECommodore 16/Plus4 cartridge! magic/c64x : "%.32s" =FMMAPBFMathematica PBF (fonts I think) = LammpS RestartTLAMMPS binary restart filex (rev %d),x Version %s,= Little Endian= Big Endian =8FUJIFILMCCD-RAWFujifilm RAF raw image dataimage/x-fuji-rafrafx;, format version %4.4sx<, camera %s =NEmbla data fileBiosig/Emblabiosig/embla =Borland C++ ProMSVC .ide ="A#S#C#S#S#L#V#3Synthesizer Generator or Kimwitu data =$A#S#C#S#S#L#HUBKimwitu++ data =W5 the_Lost_MineQuake I save: hip1m3 The lost mine =85 Vaults_of_ZinQuake I save: e3m2 Vaults of Zin =D5 The_Pain_MazeQuake I save: e4m6 The pain maze =O5 The_Dark_ZoneQuake I save: dm6 The dark zone =\5 The_CatacombsQuake I save: hip2m3 The catacombs =M5 The_Bad_PlaceQuake I save: dm4 The bad place =x5 Takahiro_BaseQuake I save: d9 Takahiro base =z5 Stayin'_AliveQuake I save: d13 Stayin' alive =t5 Nuclear_PlantQuake I save: d6 Nuclear plant =^5 Mortum's_KeepQuake I save: hip2m5 Mortum's keep =B5 Hell's_AtriumQuake I save: e4m5 Hell's atrium =5 Crazy_Eights!Quake I save: ddm3 Crazy eights! =n5 BACK_2_MALICEQuake I save: d4b Back to Malice = **** FRITZ!Box FRITZ!Box configuration backupapplication/x-avm-exportexportxof %-.4s=)FirmwareVersion=, firmware versionx%s=)OEM=, oemx%s= )1Language=, languagex%s=)]tmp.cfgmagic/avmx, %s =$ANSIBLE_VAULT;Ansible Vault=[0-9]+\.[0-9]+, version %s=;magic/linux= [A-Z0-9]+, encryption %s =q#pmieconf-rulesPCP pmieconf rules>r(V.%1.1s) =+%s =MAS_UTrack_V00magic/audio>/0ultratracker V1.%.1s module sound dataaudio/x-mod =HyperTerminal magic/windows=1.0 -- HyperTerminal data fileMS Windows HyperTerminal profileapplication/x-ms-htht =BANDAI SFC-ADXmagic/console!SFC-ADX BACKUPSufami Turbo ROM image:x "%.14s"x0, ID %02Xx1%02Xx2%02X>3, series index %u=4[SlowROM]=4[FastROM]=5[SRAM]=5[Special] = debianmagic/archive=-splitpart of multipart Debian packageapplication/vnd.debian.binary-packagedeb/udeb=-binaryDebian binary packageapplication/vnd.debian.binary-packagedeb/udeb/ipkxUnknown Debian package>D(format %s)=D2.0 magic/archive>H, with %.15s= O> data.tar., data compressionx%.2s ! magic/archive!/magic/archivex%c ! magic/archive!/magic/archivex%c=D2.1 magic/archivex, %sx%sx, MD5 %sx , unsplitted size %sx , part length %sx, part %sx, %s@= Relay-Version:old news textmessage/rfc822 <=+%PDF-PDF document (UTF-8)application/pdfpdfx , version %cx!.%c=."pdfmagic/pdf = Version:VivoVivo video data =policy_module(SE Linux policy module source =policy_module(SE Linux policy module source =]*NINTENDO-HVC*Famicom Disk System disk image:application/x-fds-disk=._nintendo-fds-disk-info-blockmagic/console =*IMA IKUNOJYUKUSamsung Pico ROM imageapplication/x-sega-pico-rom=.,sega-mega-drive-headermagic/console =)@BABYL OPTIONS:Emacs RMAILmessage/x-gnu-rmail/ =$ToKyO CaBiNeT TokyoCabinet databasex%(version %s) =ToKyO CaBiNeT Tokyo Cabinetx (%s)= , Hashapplication/x-tokyocabinet-hash= , B+ treeapplication/x-tokyocabinet-btree= , Fixed-lengthapplication/x-tokyocabinet-fixed= , Tableapplication/x-tokyocabinet-table&!, [open]&!, [fatal]x", apow=%dx#, fpow=%d&$, [large]&$, [deflate]&$, [bzip]&$, [tcbs]&$, [excodec]x(, bnum=%lldx0, rnum=%lldx8, fsiz=%lld =LUCAM-RECORDERSER video sequenceser= , bayer: mono= , bayer: RGGB=  , bayer: GRBG=  , bayer: GBRG=  , bayer: BGGR= , bayer: CYYM= , bayer: YCMY= , bayer: YMCY= , bayer: MYYC= d, bayer: RGB= e, bayer: BGR= , big-endian= , little-endianx , width: %dx , height: %dx ", %d bitx &, frames: %d =>ITEM: TIMESTEPLAMMPS text mode dump,=?[0-9]+First time step: %s = IIHEAPCCDRCanon CIFF raw image dataimage/x-canon-crwx ", version %d.x #%d =@DUMPEDGNUEMACSGNU/Emacs pdumper image =CBM2 CARTRIDGECommodore CBM-II cartridge! magic/c64x : "%.32s" =C128 CARTRIDGECommodore 128 cartridge= ,! magic/c64x : "%.32s",=generic cartridge=Warpspeed128=, REU support=, REU support, with I/O and ROM banking =AON4artofnoiseArt Of Noise Module sound file =Qt Resource Collection file =<5 Wind_TunnelsQuake I save: e3m5 Wind tunnels =l5 The_HospitalQuake I save: d10 The hospital (secret) =c5 The_GauntletQuake I save: hip3m4 The gauntlet ='5 IntroductionQuake I save: start Introduction =q5 A_Rat's_LifeQuake I save: d3 A rat's life =j##  %s 2=+bplist00magic/apple=WebMainResourceApple Safari Webarchiveapplication/x-webarchive = /Picture Magicmagic/console=0PICTURE MAGIC-01Sega 32X ROM imageapplication/x-genesis-32x-rom=.2sega-mega-drive-headermagic/console = C64 CARTRIDGEmagic/c64>Dmagic/c64=.c64-crtmagic/c64 = R(fp_lib_tablemagic/kicad= S KiCad Footprint Library Table= T KiCad Footprint Library Table= U KiCad Footprint Library Table = #!/nix/store/magic/commandsx a %s script text executable@= $delivered-to:SMTP mail textmessage/rfc822@=  "#!/bin/nodejsNode.js script executableapplication/javascript@= ; [BitmapInfo2]Polar Monitor Bitmap textimage/x-polar-monitor-bitmap@= 1 MIME-Version:MIME entity text@=  GIMP GradientGIMP gradient datatext/x-gimp-ggrggr = 't(V.%1.1s) = (C) STEPANYUKARS-Sfx archive data = 2R@"PGP sig = [Adblock PlusAdblock Plus=[0-9.]+%sxrules file= dVersion:magic/web=[0-9]+, version %s = VER=9 CTIME=Biosig/WCPbiosig/wcp = SplineFontDB:Spline Font Databaseapplication/vnd.font-fontforge-sfdxversion %s = BlockHashLocBlockHashLoc recovery info,x version %dbhl = EBambooTrackerBambooTracker= FModModule= GIstInstrument= HBnkBankxI, version %uxJ.%uxK.%u = BEGIN:IMELODYiMelody Ringtone Format = BEGIN SPECWEBSPECweb< :%.2s=_SSL_SSL<:v%.4s raw result text<:v%.4s raw result text = bCFF Song = ]5 the_Crypt__Quake I save: hip2m4 The crypt = _5 Tur_TormentQuake I save: hip3m1 Tur torment = v5 The_FoundryQuake I save: d7b The foundry = N5 The_CisternQuake I save: dm5 The cistern = h5 The_AcademyQuake I save: start The academy = 5 Sub_StationQuake I save: ddm2 Sub station = `5 PandemoniumQuake I save: hip3m2 Pandemonium = {5 B.O.S.S._HQQuake I save: d14 B.O.S.S. HQ = E5 Azure_AgonyQuake I save: e4m7 Azure agony =  %SEMI-OASIS OASIS Stream file = ^#SUNPC_CONFIGSunPC 4.0 Properties Values = Q%-12345X@PJLHP Printer Job Language data=`'@PJL ENTER LANGUAGE=HBPL- HBPL=a'@PJL ENTER LANGUAGE=HIPERC- Oki Data HIPERC=b'@PJL ENTER LANGUAGE=LAVAFLOW- Konica Minolta LAVAFLOW=c'@PJL ENTER LANGUAGE=QPDL- Samsung QPDL=d'@PJL ENTER LANGUAGE = QPDL- Samsung QPDL=e'@PJL ENTER LANGUAGE=ZJS- HP ZJS=g'%!PJL encapsulated PostScript document text = %-12345X%!PSPostScript document =(Windows Registry Editor magic/windows=2)Version 5.00 Windows Registry little-endian text (Win2K or above)text/x-ms-regeditreg = KEYB magic/msdos= `MS-DOS KEYBoard Layout file = makedumpfilemagic/linux=magic/linux=KDUMP Flattened kdump compressed dump=.kdump-compressed-dumpmagic/linux = } Packed File magic/archive= Personal NetWare Packed Fileapplication/x-novell-compress??_x , was "%.12s"x  with %u bytes@= $return-path:SMTP mail textmessage/rfc822@= "@#! /bin/tcshTenex C shell script text executabletext/x-shellscript@= 3"@#! /bin/nawknew awk script text executabletext/x-nawk@= 9"@#! /bin/gawkGNU awk script text executabletext/x-gawk@= _"@#! /bin/dashDash shell script text executabletext/x-shellscript@= J"@#! /bin/bashBourne-Again shell script text executabletext/x-shellscript@=  GIMP PaletteGIMP palette datatext/x-gimp-gplgpl@=  /1 :pserver:cvs password text file@=  //Maya ASCIIAlias Maya Ascii File,> version %s P=+#GIF8GIF image dataimage/gif8BIMGIFfgif=(7a, version 8%s,=)9a, version 8%s,> *%d x> +%d <=+ %PDF-PDF documentapplication/pdfpdfx, version %cx.%c=.pdfmagic/pdf = $SAMSUNG PICOSamsung Pico ROM imageapplication/x-sega-pico-rom=.&sega-mega-drive-headermagic/console = LB@#! /bin/bashBourne-Again shell script executable (binary data)text/x-shellscript = Y @ITSF`MS Windows HtmlHelp Dataapplication/vnd.ms-htmlhelpchm = @C64-TAPE-RAWCommodore raw Tape image (platformapplication/x-commodore-tapetap= C64= VIC-20= C16 Plus/4= PET= C5x0= C6x0 C7x0> "%#2.2xx #),x (Version:%u,x *Length:%u cyclesx,, video=-PAL=.NTSC=/old NTSC=0PALN>2%#2.2x!4, at 0xF %#2.2x = > xx %u> yx %u> z, %u layers> ${, %u faces> (|, %u mipmaps> ,},=.,~khronos-ktx2-supercompressionmagic/images> ,=. khronos-ktx2-vkFormatmagic/images = c KTX 11  Khronos KTX textureimage/ktxktx= f (little-endian)=.g khronos-ktx-endian-headermagic/images= h (big-endian)=.i ^khronos-ktx-endian-headermagic/images = xSceneEditorMovieSetter movie = xMovieSetterMovieSetter movie = tfMR MS Windows help cache = CglsBeginGLS(GLS_TEXT = btrfs-streamBTRFS stream file = vTWIN97012000VQF data=w, Mono=x, Stereo>y, %d kbit/s>#z, %d kHz = UTADS2 save/gTADS! V saved game data, CORRUPTED= W magic/adventure>  X%s saved game dataapplication/x-tads = 1Playdate VIDPlaydate video filex 2%d xx 3%d,x 4%d frames,x#5%.2f FPS = "Playdate STRPlaydate localization strings= #(compressed)= $(uncompressed) = 9Playdate PDZPlaydate executable package = Playdate IMTPlaydate image data set= (compressed)x %d xx %d,x %d cells= (uncompressed)x tile grid %d xx %d = Playdate IMGPlaydate image data= (compressed)x %d xx %d= (uncompressed)x %d xx %d = 'Playdate AUDPlaydate audio filex (%d Hz,=)unsigned, 8-bit PCM, 1 channel=*unsigned, 8-bit PCM, 2 channel=+signed, 16-bit little-endian PCM, 1 channel=,signed, 16-bit little-endian PCM, 1 channel=-4-bit ADPCM, 1 channel=.4-bit ADPCM, 2 channel = LDLINUX SYS SYSLINUX loaderx (older version %-4.4s) = KenSilvermanBuild engine group filex containing %d files = Joy!peffpwpcheader for PowerPC PEF executable = QHeader FileVersion Biosig/ETG4000biosig/etg4000 = DVDVIDEO-VTSVideo title set,video/x-ifoifo/bupx!v%x = DVDVIDEO-VMGVideo manager,video/x-ifoifo/bupx!v%x = DTJPCH0CMicrosoft Visual C .pch = CyrSBytecodeCyrus sieve bytecode data,= version 1, big-endian= version 1, little-endianx version %d, network-endian = @(#)SunPHIGSSunPHIGS=(SunBinbinary= archivearchive = 35 UnderearthQuake I save: e2m7 Underearth (secret) = -5 Gloom_KeepQuake I save: e1m5 Gloom keep = S5 Command_HQQuake I save: start Command HQ = ^0 HEADGEDCOM genealogy texttext/vnd.familysearch.gedcomged= beVERSversionxd%sxe, UTF-16 (without BOM) little-endian text = *dvdisaster*dvdisaster error correction file = K*PPD-Adobe: PPD filexL, version %sapplication/vnd.cups-ppdppd = j#pmdahotprocPCP pmdahotproc config= kVersionmagic/sgi>l(V%-3.3s) = ;#Inventor V2Open Inventor 2.0 file = ## SE Linux policy interface source = #!teapot xdrteapot work sheet (XDR format) = K  /magic/psl< :(Version %c) = +(*^ ::[ magic/mathematica=.,wolframmagic/mathematica = /(*^ ::[ magic/mathematica=.0wolframmagic/mathematica@= ""@#! /bin/zshPaul Falstad's zsh script text executabletext/x-shellscript@= "@#! /bin/kshKorn shell script text executabletext/x-shellscript@= "@#! /bin/cshC shell script text executabletext/x-shellscript@= @"@#! /bin/awkawk script text executabletext/x-awk@= +"@#! /bin/ashNeil Brown's ash script text executabletext/x-shellscript@= "#!/bin/nodeNode.js script executableapplication/javascript F=+AMM*TIFF image data, big-endianimage/tifftif/tiff= .E^tiff_ifdmagic/images F=+FII*TIFF image data, little-endianimage/tifftif/tiff=. Jtiff_ifdmagic/images <=+ %PDF-PDF documentapplication/pdfpdfx, version %cx.%c=.pdfmagic/pdf <=+&%FDF-FDF documentapplication/vnd.fdfpdfx*, version %cx+.%c =*]ELFELF=_invalid class=`32-bit=a64-bit=binvalid byte order=cLSB=.delf-lemagic/elf=eMSB=.f^elf-lemagic/elf=g(SYSV)=h(HP-UX)=i(NetBSD)=j(GNU/Linux)=k(GNU/Hurd)=l(86Open)=m(Solaris)=n(Monterey)=o(IRIX)=p (FreeBSD)=q (Tru64)=r (Novell Modesto)=s (OpenBSD)=t (OpenVMS)=u(HP NonStop Kernel)=v(AROS Research Operating System)=w(FenixOS)=x(Nuxi CloudABI)=ya(ARM)=zf(Cell LV2)={(Cafe OS)=|(embedded) = 5%!FontType1PostScript Type 1 font program datafont/x-postscript-pfbpfb>9(%s) = &Spreadsheetsc spreadsheet fileapplication/x-sc = 5make configLinux make config build file (old) =  yRABBITGRAPHRabbitGraph file = .%!FontType1PostScript Type 1 font program datafont/x-postscript-pfbpfb>3(%s) = pgscriptverIslandWrite document = typedstreamNeXT/Apple typedstream data, big endianx, version %d<magic/apple= magic/applex, system %d = streamtypedNeXT/Apple typedstream data, little endianx, version %d<magic/apple= magic/applex , system %d =  ACROSS&DOWNPUZ crossword puzzlex, %d xx-%d,x .%d clues,= plain text solution! scrambled solution = B@#! /bin/kshKorn shell script executable (binary data)text/x-shellscript = ظfooOLD_VARIANT Linux= x86 boot sector=.kernel-version-old2magic/linux! x86 kernel=.kernel-info-oldmagic/linux=.kernel-version-old3magic/linux=.kernel-version-4magic/linux = <ncursesncurses6 screen image = 4ssh-ed25519OpenSSH ED25519 public keytext/x-ssh-public-keypub = mscdocumentMessage Sequence Chart (document) = Fiptrace 2.0AIX iptrace capture file = Eiptrace 1.0AIX iptrace capture file =  filedesc://Internet Archive Fileapplication/x-ia-arc=  magic/warc> version %c = $divert(-1) sendmail m4 text file =  d8:announceBitTorrent fileapplication/x-bittorrenttorrent = \[depot\] Quick Database Manager, little endian = \[DEPOT\] Quick Database Manager, big endian = WOPL3-INSTWOPL instrumentx , version %u = WOPL3-BANKWOPL instrument bankx , version %u = OctaMEDCmprOctaMED Soundstudio compressed file = NuppelVideoMythTV NuppelVideox v%sx (%dx x%d),=$Pprogressive,=$Iinterlaced,x&(aspect:%.2f,x&0fps:%.2f = 1ClamAV-VDB:Clam AntiVirus=3 databaseapplication/x-clamav-database= 6::(unsigned)cudx <(with buildtime)cld/cvd/clamtmp/cudxAfileapplication/x-clamavinfo> Dmagic/fsav=  F^[^:]{0,23}, %s= H^[^:]{1,6}, version %s= J^[^:]{1,10}, %s signatures= L^[^:]{1,4}, level %s= O^[^:]{1,32}magic/fsav= R^[^:]{1,255}magic/fsav= T^[^:]{1,32}, builder %s = W^[^:]{1,10}magic/fsav=Z magic/fsav=^, with=._tar-filemagic/fsav!amagic/fsav=c, with x)dmagic/fsav = qAntiVir QuaAvira AntiVir quarantinedapplication/x-avira-quaqua=uSUSPICIOUS_FILEmagic/fsavxw%s!xSUSPICIOUS_FILEmagic/fsavxz%sx<|at %s!~SUSPICIOUS_FILEmagic/fsavx, category "%s" = AMOS Basic AMOS Basic source code= V, tested= v, untested = J amagic/filesystems=bmagic/filesystems=cDOS/MBR boot sectorxd, code offset %#x+2=emagic/filesystemsx f, code offset %#x+3>g, OEM-ID "%-.8s"=iIHC cached by Windows 9M> j, Bytes/sector %u< l, Bytes/sector %u> m, sectors/cluster %u=Rpfat32magic/filesystems! q , reserved sectors %u!Rsfat32magic/filesystems> t, reserved sectors %u>w, FATs %u=y, FAT %u>zmagic/filesystems> {, root entries %u> }, sectors %u (volumes <=32 MB)>, Media descriptor %#x<, Media descriptor %#x> , sectors/FAT %ux , sectors/track %u>, heads %u=, heads %u>  magic/filesystems=&Vmagic/filesystems> , hidden sectors %u> , sectors %u (volumes > 32 MB)!Rfat32magic/filesystems!$magic/filesystems !$, physical drive %#x>%, reserved %#x!&), dos < 4.0 BootSector (%#x)=&(magic/filesystems x ', serial number %#x=&)magic/filesystems <+NO NAME, label: "%11.11s" >+NO NAME, label: "%11.11s" =+NO NAME, unlabeled!Rfat32magic/filesystems=6FAT12, FAT (12 bit)=6FAT16, FAT (16 bit)x6magic/filesystems<, FAT (12 bit by descriptor)=magic/filesystems> , FAT (16 bit by descriptor+sectors)x , FAT (12 bit by descriptor+sectors)=magic/filesystems= , FAT (12 bit by descriptor+geometry)x, FAT (1Y bit by descriptor)=magic/filesystems=, FAT (12 bit by descriptor+geometry)x, FAT (1Y bit by descriptor)x, FAT (12 bit by descriptor)=Rfat32, FAT (32 bit)x $, sectors/FAT %u> (, extension flags %#x> *, fsVersion %u> ,, rootdir cluster %u> 0, infoSector %u< 0, infoSector %u= 2, no Backup boot sector= 2, no Backup boot sectorx2magic/filesystemsx 2, Backup boot sector %u> 4, reserved1 %#x> 8, reserved2 %#x> <, reserved3 %#x!@magic/filesystems>@, physical drive %#x>A, reserved %#x!B), dos < 4.0 BootSector (%#x)=B)magic/filesystemsx C, serial number %#x<GNO NAME, label: "%11.11s">GNO NAME, label: "%11.11s"=GNO NAME, unlabeled!magic/filesystems!6FAT16magic/filesystems= , followed by FATapplication/x-ima=magic/filesystems= magic/filesystems= magic/filesystems= ; NTFS > , sectors/track %u ! $, physical drive %#x >(, sectors %lld >0, $MFT start cluster %lld >8, $MFTMirror start cluster %lld < @magic/filesystems < @, clusters/RecordSegment %d >@, bytes/RecordSegment 2^(-1*%i) < D magic/filesystems < D , clusters/index block %d >D, bytes/index block 2^(-1*%i) xH, serial number 0%llx > P, checksum %#x x magic/filesystems =$; containsimg/bin/ntfs = .ntfs-sector2magic/filesystems = reMarkablemagic/images= linesmagic/images=withmagic/images= selectionsmagic/images=!andmagic/images=%layersmagic/imagesx +reMarkable tablet notebook lines, 1404 x 1872, %x page(s)= .linesmagic/images=file,magic/images=version=magic/imagesx reMarkable tablet page (v%c), 1404 x 1872,x +%d layer(s) = hT3-state-vmagic/adventure=i TADS 3 saved game data (format versionx j%cx k%cx l%cx m%c)application/x-t3vm-image = ~HEADER magic/scientific=^.{40}magic/scientific=[0-9]{2}-[A-Z]{3}-[0-9]{2} {3}magic/scientific=[A-Z0-9]{4}.{14}$magic/scientific= [A-Z0-9]{4}Protein Data Bank data, ID Code %schemical/x-pdb=[0-9]{2}-[A-Z]{3}-[0-9]{2}, %s =  (kicad_schmagic/kicad= KiCad Schematic Documentkicad_sch/kicad_sch-bak= (versionmagic/kicad= magic/kicad=[0-9.]+(Version %s) = 6(kicad_pcbmagic/kicad= 7 KiCad Board Layoutkicad_pcb/kicad_pcb-bak= 9(versionmagic/kicad=: magic/kicad=;[0-9.]+(Version %s)@= "@#! /bin/shPOSIX shell script text executabletext/x-shellscript@= G"@#! /bin/rcPlan 9 rc shell script text executable@=  [MapFiles]GTA2 multiplayer map metadata (MMP)@=  Forward tomail forwarding textmessage/rfc822 = mSWAPSPACE2Linux swap file, 64k page size,= .nlinux-swapmagic/linux = RSWAP-SPACELinux old swap file, 64k page size = kSWAPSPACE2Linux swap file, 32k page size,= .llinux-swapmagic/linux = QSWAP-SPACELinux old swap file, 32k page size = ?iSWAPSPACE2Linux swap file, 16k page size,= .jlinux-swapmagic/linux = ?PSWAP-SPACELinux old swap file, 16k page size = gSWAPSPACE2Linux swap file, 8k page size,= .hlinux-swapmagic/linux = OSWAP-SPACELinux old swap file, 8k page size = eSWAPSPACE2Linux swap file, 4k page size,= .flinux-swapmagic/linux = NSWAP-SPACELinux old swap file, 4k page size = SWAPSPACE2Linux swap file, 64k page size,= .linux-swapmagic/linux=.linux-hibernatemagic/linux = SWAPSPACE2Linux swap file, 32k page size,= .linux-swapmagic/linux=.linux-hibernatemagic/linux = ?~SWAPSPACE2Linux swap file, 16k page size,= .linux-swapmagic/linux=.?linux-hibernatemagic/linux = {SWAPSPACE2Linux swap file, 8k page size,= .|linux-swapmagic/linux=.}linux-hibernatemagic/linux = xSWAPSPACE2Linux swap file, 4k page size,= .ylinux-swapmagic/linux=.zlinux-hibernatemagic/linux = qLockStreamLockStream Embedded file (mostly MP3 on old Nokia phones) = <zW CollisCOM executable for MS-DOS, Compack compressedapplication/x-dosexeccom = +SFDU_LABELVICAR label file =  wGERBILCLIPFirst Choice database = 18 !NTITLEXPLOR ASCII Electron Density Map = ^ @GFA-BASIC3GFA-BASIC 3 data =  B@#! /bin/shPOSIX shell script executable (binary data)text/x-shellscript=* # This script was generated using Makeself, self-executable archivex5 , Makeself %s = @@%c<A%cxmagic/frame= %.hlp:) helphlpx&magic/frame=(link magic/frame=*^[A-Za-z0-9.: ]{1,}with "%s"x-)/fm/doc/toc/ix = :-) OriginBRIX Electron Density Map>0, Sigma:%.12s = sNaPpYsnappy framed dataapplication/x-snappy-framed = BoomBoom or linuxdoom demo = ABCDEFGHHP LaserJet 1000 series downloadable firmware = :perl-storeperl Storable (v0.6) data>;(net-order %d)&<(network-ordered)==(major 1)=>(major 1) =  d7:commentBitTorrent fileapplication/x-bittorrenttorrent = (U2FsdGVkX1openssl enc'd data with salted password, base64 encoded = \TADS2 saveTADS! ] saved game data, CORRUPTED= ^ magic/adventure>_%s saved game dataapplication/x-tads = /RAXIS R-Axis Area Detector Image, Win32:< 0Little-endian, IP #%d,> 1Size=%dx> 2%d<3Big-endian, IP #%d,>4Size=%dx>5%d = 'R-AXIS4 R-Axis Area Detector Image:< (Little-endian, IP #%d,> )Size=%dx> *%d<+Big-endian, IP #%d,>,Size=%dx>-%d = Octave-1-LOctave binary data (little endian) = Octave-1-BOctave binary data (big endian) = NõFélxåNuLIB archive data = *MegaCad23MegaCAD 2D/3D drawing = MeTaSt00r3Metastore data file,x version %0llx = 4JASC-PAL PaintShop Pro color palettepal/PspPalette! 90100, version %.4sx;, %.3s colors = %HeaderLen=Biosig/BCI2000 = FTNCHEK_ Pproject file for ftnchek= 1version 2.7= 2version 2.8 to 2.10= 3version 2.11 or later = Dirk PaehlDPA archive data = BitmapfileHP Bitmapfile = ARF_BEGARFPHIGS clear text archive = @document(Imagen printer= language impress(imPRESS data)= language daisy(daisywheel text)= language diablo(daisywheel text)= language printer(line printer emulation)= language tektronix(Tektronix 4014 emulation) =  disk image data (YAZE) = B(C) CED 87Biosig/CED SMR biosig/ced-smr = %% TDR 2.0IVS Fledermaus TDR file = e## versioncatalog translation = /1.4OiCEDraw graphicimage/x-idfidf 7=+HdrSLinux kernelapplication/x-linux-kernel/dat/bin/lnx= Ux86 boot executable= .kernel-infomagic/linux =  magic/filesystems= magic/filesystems> magic/filesystemsx YAFFS filesystem root entry (little endian)=. yaffsmagic/filesystems = SIMPLE =magic/images=Y FITS image= G@ZCMPTYPE=data, compression typefz=[A-Z_1-2]{4,11}%sxdatafits/fit/fts= PQ@BITPIX =magic/images=8, 8-bit, character or unsigned binary integer=8, 8-bit, character or unsigned binary integerx(too right positioned)= 8, 8-bit, character or unsigned binary integerx(too left positioned)=16, 16-bit, two's complement binary integer= 32, 32-bit, two's complement binary integer=-32, 32-bit, floating point, single precision=-64, 64-bit, floating point, double precision= 64, 64-bit, two's complement binary integer= PQ@NAXIS =,=@ 0 0 axesapplication/fits=@ 1 1 axisapplication/fits=@ 2 2 axesimage/fits=@ 3 3 axesimage/fitsxmagic/images= [0-9]{1,3}%s axisapplication/fits= rPNAXIS1 =,=  [0-9]{1,31}%s= @qPNAXIS2 =x=  [0-9]{1,31}%s! PBITPIX =, at 80xP"%-0.9s"! NAXIS =, at 160x"%-0.9s" = MANIFEST magic/gentoo=.gentoo-manifestmagic/gentoo = )(*^ ::[ magic/mathematica=.*wolframmagic/mathematica = 3(*^ ::[ magic/mathematica=.4wolframmagic/mathematica = 5(*^ ::[ magic/mathematica=.6wolframmagic/mathematica = `Lmagic/apple= SYSTEM.APPLEmagic/apple= magic/apple=  Apple Pascal Imagex  , Volume %s:x  , %u Blocksx  , %u Files =  magic/apple=Apple Diversi Dos Imagex, Volume %ux4, %u Tracksx5, %u Sectorsx 6, %u bytes per sector = +JJmagic/apple=magic/applexApple DOS 3.%u Unbootable Imagex, Volume #%03ux4, %u Tracksx5, %u Sectorsx 6, %u bytes per sector@=+=$HTML document texttext/html@= / Received:RFC 822 mail textmessage/rfc822@=  N#! rnewsmailed, batched news textmessage/rfc822 2=+DISODelta ISO dataxversion %d = DECFILE11Files-11 On-Disk Structurex (ODS-%d);=ARSX-11, VAX/VMS or OpenVMS VAX file system;=Bmagic/filesystems= VAX/VMS or OpenVMS file system;= OpenVMS Alpha or Itanium file system;xvolume label is '%-12.12s' = 4ReIsEr3FsReiserFS V3.6.19x ,block size %d& 2(mounted or unclean)x num blocks %d= @tea hash= @yura hash= @r5 hash = 4 ReIsEr2FsReiserFS V3.6 = &MaDoKaN96XMS Adlib Module>Composer: "%s" =  Atari-ST floppy 360k =   DOS floppy 360k= U, DOS/MBR hard disk boot sector =  DOS floppy 720k, IBM= U, DOS/MBR hard disk boot sector =  Atari-ST floppy 720k =  DOS floppy 720k= U, DOS/MBR hard disk boot sector = @  DOS floppy 1440k, mkdosfs= U, DOS/MBR hard disk boot sector = @ DOS floppy 1440k= U, DOS/MBR hard disk boot sector =  uGERBILDOCFirst Choice document = OracleCFSOracle Clustered Filesystem,xrev %dx.%d,x0label: %.64s,xmountpoint: %.128s =  gtktalog GTKtalog catalog data,= 3version 3= zg(gzipped)! zg(not gzipped)>  3version %s = wpmlogconfPCP pmlogger config> x(V.%1.1s) = @WordPro Lotus WordProapplication/vnd.lotus-wordpro = h@databaseAmigaGuide file = t)< :%c)> :%c)! , no space before version = LZO  lzop compressed dataapplication/x-lzoplzo< @ magic/compress= - version 0.x %03x,= LZO1X-1,= LZO1X-1(15),= LZO1X-999,=os: MS-DOS=os: Amiga=os: VMS=os: Unix=os: Atari=os: OS/2=os: MacOS= os: Tops/20= os: WinNT=os: Win32> 9 magic/compress= - version 0.= - version 1.= - version 2.x %03x,=LZO1X-1,=LZO1X-1(15),=LZO1X-999,=os: MS-DOS=os: Amiga=os: VMS=os: Unix=os: Atari=os: OS/2=os: MacOS= os: Tops/20= os: WinNT=os: Win32 = V{VERSION Maple worksheet> Wversion %.1s.> X%.1s = personal_aspell personal= ws-dictionarytext/x-aspell-dictionarypws= repl-replacement dictionarytext/x-aspell-dictionaryprepl = d_A2moduleA2M Song = VimCrypt~Vim encrypted file data= 01!with zip cryptmethod= 02!with blowfish cryptmethod= 03!with blowfish2 cryptmethod = 'TFMX-SONGTFMX module sound data = MTADS2 rscTADS! N resource data, CORRUPTED= O magic/adventure> P%s resource dataapplication/x-tads = GTADS2 binTADS! H game data, CORRUPTED= I magic/adventure> J%s game dataapplication/x-tads = StartFontASCII font bits = SBMBAKUP_Smart Boot Manager backup filex , version %-5.5s=_magic/filesystemsx%-.1s=_.x%-.1s=_.x%-.1s=magic/filesystemsx, from drive %#x>magic/filesystemsx, from drive %s=Umagic/filesystemsx); contains = PNCIHISKNorton Utilities disc image data=Umagic/filesystemsx); contains =  PLUS3DOSSpectrum +3 data= - BASIC program= - number array=- character array=- memory block=@(screen)=- Tasword document=TAPEFILE- ZXT tapefile =  HWBMicrosoft Visual C .APS file = CRYPTEDDovecot encrypted messagex , dcrypt version %d = >AGD4Macromedia Freehand 9 Document = <AGD3Macromedia Freehand 8 Document = ;AGD2Macromedia Freehand 7 Document = IA/E SGML binary styles file> Type %s =  Compiled SGML rules file> Type %s =  A/E SGML Document binary> Type %s = i5 The_LabQuake I save: d1 The lab = j5 Area_33Quake I save: d1b Area 33 = g#pmloggerPCP pmlogger config= hVersionmagic/sgi>i(V%1.1s) = |!MKS Spell hash list = yBud1Apple Desktop Services Store A=+P7magic/images!magic/images=@WIDTHNetpbm PAM image file, size =image/x-portable-arbitrarymappamx%s=@HEIGHTxx%s!  , %#x at offset 2 instead new line A=+P6magic/images= P6[ ]magic/images=.netpbmmagic/imagesx, rawbits, pixmapimage/x-portable-pixmapppm/pnm A=+P5magic/images= P5[ ]magic/images=.netpbmmagic/imagesx, rawbits, greymapimage/x-portable-greymappgm A=+P4magic/images= P4[ ]magic/images=.netpbmmagic/imagesx, rawbits, bitmapimage/x-portable-bitmappbm #=+CD001magic/filesystems=.cdrommagic/filesystems A= +UDOS/MBR boot sector=OSBSOS/BS MBR=3м|MS-MBR="PPmagic/filesystems=$,DOS 2= %Author - Author:x'"%s"=(magic/filesystems="+uZ=|,NEC 3.3x"-,D0S version 3.3-7.0=I1Invalid partition tableenglish=I2Ungltige Partitionstabellegerman=I3Table de partition invalidefrench=I4Tabela de partiao invlidaportuguese=I5Tabla de particin no vlidaspanish="I6Tavola delle partizioni non validaitalian>I7at offset %#x>I8"%s">t?at offset %#x>t@"%s">yGat offset %#x>yH"%s"=K|PPmagic/filesystems=Mˤ9M=<RInvalid partition tableenglish=<SUngltige Partitionstabellegerman=<TTable de partition erronefrench=<Uࠢ쭠 ⠡russianx<Vat offset %#x+0xFF><W"%s"x\at offset 0x1%x>]"%s"xbat offset 0x1%x>c"%s"=fˤXP=hcD,english=inH,german>lat offset 0x1%x>m"%s">pat offset 0x1%x>q"%s">tat offset 0x1%x>u"%s"=x|؎magic/filesystems={PCTf;uVista=}zbenglish>at offset 0x1%x>"%s">at offset 0x1%x>"%s">at offset 0x1%x>"%s"=uAPCTfWindows 7={cenglish>at offset 0x1%x>"%s">at offset 0x1%x>"%s">at offset 0x1%x>"%s"> , disk signature %#-.4x= magic/filesystems> , createdxwith driveID %#xxat %xx:%xx:%x=Ў0magic/filesystems=؎MS-MBR,D0S version 3.21 spanish=Invalid partition table$magic/filesystems=No Operating System$magic/filesystems=Operating System load error$, DR-DOS MBR, Version 7.01 to 7.03=Invalid partition table$magic/filesystems=No operating system$magic/filesystems=Operating system load error$, DR-DOS MBR, Version 7.01 to 7.03=VInvalid partition table$magic/filesystems=nNo operating system$magic/filesystems=Operating system load error$, DR-DOS MBR, version 7.01 to 7.03='NEWLDRmagic/filesystems=.Bad PT $magic/filesystems=6No OS $magic/filesystems= =OS load err$magic/filesystems=IMoved or missing IBMBIO.LDR magic/filesystems=fPress any key to continue. $magic/filesystems=Copyright (c) 1984,1998magic/filesystems= Caldera Inc., DR-DOS MBR (IBMBIO.LDR)= EDefault: F, FREE-DOS MBR=@no active partition foundmagic/filesystems=`read error while reading drive, FREE-DOS Beta 0.9 MBR=  Error! magic/filesystems=zVirus!magic/filesystems=Booting magic/filesystems=HD1/, Ranish MBR (=Writing changes...2.37x,%#x dots>,virus check>,partition %c!Writing changes...magic/filesystems=virus check,x%#x seconds>,partition< %x= askx)= jMBR Error magic/filesystems=xress any key to magic/filesystems=boot from floppy..., Acronis MBR=5No bootable partition found magic/filesystems=SI/O Error reading boot sector , Visopsys MBR=]No bootable partition found magic/filesystems={I/O Error reading boot sector , simple Visopsys MBR=@SBMLmagic/filesystems= +SMART BTMGRmagic/filesystems= SBMK Bad! , Smart Boot Manager>, version %s= ~XOSLLOADXCF, eXtended Operating System Loader=LILO, LInux i386 boot LOader=xLILO, version 22.3.4 SuSe=LILO, version 22.5.8 Debian=V<Geommagic/filesystems<Amagic/filesystems>>; GRand Unified Bootloaderx>, stage1 version %#x<@, boot drive %#x>A, LBA flag %#x< B, stage2 address %#x> B, stage2 address %#x> D , 1st sector stage2 %#x< H , stage2 segment %#x> H , stage2 segment %#x= GeomHard DiskRead Errormagic/filesystems=stage1, GRUB version 0.5.95=~GeomHard DiskRead Errormagic/filesystems=xGRUB , GRUB version 0.93 or 1.94=GeomHard DiskRead Errormagic/filesystems=yGRUB , GRUB version 0.94=GeomHard DiskRead Errormagic/filesystems={GRUB , GRUB version 0.95 or 0.96=GeomHard DiskRead Errormagic/filesystems=GRUB , GRUB version 0.97=WGeomRead Errormagic/filesystems=ALoading stage1.5, GRUB version x.y=|GeomHard DiskRead Errormagic/filesystems=vGRUB , GRUB version n.m=chksum ERROR!, Gujin bootloader=BCDLmagic/filesystems=  BCDL BIN, Bootable CD Loader (1.50Z)!#IHISKmagic/filesystems!%magic/filesystems!'HdrSmagic/filesystems!)Be Boot Loadermagic/filesystems=+magic/filesystems =-؎1magic/filesystems=..partition-tablemagic/filesystems!0magic/filesystems!2RRaAmagic/filesystems!5fFfmagic/filesystems!7NfFfmagic/filesystems !9 magic/filesystems =;magic/filesystems =.<partition-tablemagic/filesystems >=magic/filesystems =.>partition-tablemagic/filesystems=DNon-system disk, magic/filesystems=Epress any key..., Acronis Startup Recovery LoaderxImagic/filesystems= .JDOS-filenamemagic/filesystems=LFDBOOT Version magic/filesystems=M No Systemdisk. magic/filesystems=NBooting from harddisk. magic/filesystems=OCannot load from harddisk. magic/filesystems=PInsert Systemdisk magic/filesystems=#Qand press any key. , FDBOOT harddisk Bootloader>R, version %-3s=SBootsector from C.H. Hochstmagic/filesystems=WBootsector from C.H. Hochstmagic/filesystems=$XNo Systemdisk. Booting from harddiskmagic/filesystems=ZCannot load from harddisk.magic/filesystems=$\Insert Systemdisk and press any key.magic/filesystems=^`Disk formatted with WinImage , WinImage harddisk Bootloaderx`, version %-4.4s =amagic/filesystems =bmagic/filesystems =cmagic/filesystems =eSmagic/filesystems =f|magic/filesystems =hmagic/filesystems =i"magic/filesystems = jmagic/filesystems = ktmagic/filesystems = l magic/filesystems = mVmagic/filesystems = n, mkdosfs boot message display =p[magic/filesystems>[q"%-s" =swmagic/filesystems>wt"%-s"=uPlease try to install FreeDOS , DOS Emulator boot message display=gzThis is not a bootable disk. magic/filesystems={Please insert a bootable magic/filesystems= |floppy and magic/filesystems=}press any key to try again... , FREE-DOS message display=BSolaris Boot Sectormagic/filesystems=cIncomplete MDBoot load.magic/filesystems=YVersion, Sun Solaris Bootloaderxaversion %c=OS/2 !! SYS01475 magic/filesystems=OS/2 !! SYS02025 magic/filesystems=OS/2 !! SYS02027 magic/filesystems= OS2BOOT , IBM OS/2 Warp bootloader=OS/2 !! SYS01475 magic/filesystems=OS/2 !! SYS02025 magic/filesystems=OS/2 !! SYS02027 magic/filesystems= OS2BOOT , IBM OS/2 Warp Bootloader=pThis disk is not bootable magic/filesystems=If you wish to make it bootablemagic/filesystems=run the DOS program SYS magic/filesystems= after the magic/filesystems=system has been loaded magic/filesystems=Please insert a DOS diskette magic/filesystems=into the drive and magic/filesystems=$strike any key..., IBM OS/2 Warp message display=NTLDR is missing magic/filesystems= Disk error magic/filesystems=Press any key to restart , Microsoft Windows XP Bootloader>magic/filesystemsx%-.5s>magic/filesystemsx%-.3s>magic/filesystems> .%-.3s>s magic/filesystems>pmagic/filesystemsxp%-.5s>umagic/filesystemsxu%-.3s>xmagic/filesystemsxx.%-.3s=NTLDR nicht gefunden magic/filesystems=Datentrgerfehler magic/filesystems=Neustart mit beliebiger Taste , Microsoft Windows XP Bootloader (german)>magic/filesystemsx%-.5s>magic/filesystemsx%-.3s>magic/filesystems> .%-.3s={magic/filesystems>pmagic/filesystemsxp%-.5s>umagic/filesystemsxu%-.3s=NTLDR fehlt magic/filesystems=Datentrgerfehler magic/filesystems=Neustart mit beliebiger Taste , Microsoft Windows XP Bootloader (2.german)>magic/filesystemsx%-.5s>magic/filesystemsx%-.3s>magic/filesystems> .%-.3s>s magic/filesystems>pmagic/filesystemsxp%-.5s>umagic/filesystemsxu%-.3s>xmagic/filesystemsxx.%-.3s=NTLDR fehlt magic/filesystems=Medienfehler magic/filesystems=Neustart: Taste drcken , Microsoft Windows XP Bootloader (3.german)>s magic/filesystems>pmagic/filesystemsxp%-.5s>umagic/filesystemsxu%-.3s>xmagic/filesystemsxx.%-.3s>magic/filesystemsx%-.5s>magic/filesystemsx%-.3s>magic/filesystems> .%-.3s=Datentrger entfernen magic/filesystems=Medienfehler magic/filesystems=Neustart: Taste drcken , Microsoft Windows XP Bootloader (4.german)={magic/filesystems>pmagic/filesystemsxp%-.5s>umagic/filesystemsxu%-.3s>xmagic/filesystemsxx.%-.3s>magic/filesystemsx%-.5s>magic/filesystemsx%-.3s>magic/filesystems> .%-.3s=Fehler beim Lesen magic/filesystems=des Datentrgersmagic/filesystems= NTLDR fehltmagic/filesystems=NTLDR ist komprimiertmagic/filesystems=Neustart mit Strg+Alt+Entf , Microsoft Windows XP Bootloader NTFS (german)=9A disk read error occurred. magic/filesystems=YA kernel file is missing magic/filesystems=rfrom the disk. magic/filesystems=NTLDR is compressedmagic/filesystems=Insert a system diskette magic/filesystems=and restart the system. , Microsoft Windows XP Bootloader NTFS>magic/filesystems=Invalid system disk magic/filesystems=Disk I/O errormagic/filesystems=Replace the disk, and magic/filesystems= press any key, Microsoft Windows 98 Bootloader>magic/filesystemsx %-.2s>magic/filesystems x%-.5s >magic/filesystems x %-.1s> magic/filesystemsx .%-.3s> +x%-.5s >magic/filesystems x%-.3s>magic/filesystems x.%-.3s=Invalid system disk magic/filesystems=Disk I/O error magic/filesystems=Replace the disk, and magic/filesystems=then press any key , Microsoft Windows 98 Bootloader=Ungueltiges System magic/filesystems=E/A-Fehler magic/filesystems=Datentraeger wechseln und magic/filesystems=Taste druecken , Microsoft Windows 95/98/ME Bootloader (german)>magic/filesystemsx%-.5s>magic/filesystems x %-.1s >!magic/filesystems x"%-.1s >#magic/filesystems x$%-.1s>%magic/filesystemsx&.%-.3s>(orx) %-.2s>*magic/filesystems x+%-.5s >,magic/filesystems x-%-.1s>.magic/filesystemsx/.%-.3s>1+x2%-.5s >3magic/filesystems x4%-.3s>5magic/filesystems x6.%-.3s=8Ungueltiges System magic/filesystems=9E/A-Fehler magic/filesystems=:Datentraeger wechseln und magic/filesystems=;Taste druecken , Microsoft Windows 95/98/ME Bootloader (German)>=magic/filesystemsx>%-.7s>?magic/filesystems x@%-.1s>Amagic/filesystemsxB.%-.3s>DorxE %-.2s>Fmagic/filesystems xG%-.6s>Hmagic/filesystemsxI.%-.3s>K+xL%-.5s >Mmagic/filesystems xN%-.3s>Omagic/filesystems xP.%-.3s=RUngueltiges System magic/filesystems=SE/A-Fehler magic/filesystems=TDatentraeger wechseln und magic/filesystems=UTaste druecken , Microsoft Windows 95/98/ME Bootloader (GERMAN)xW%-.2s>Xmagic/filesystemsxY%-.5s>Zmagic/filesystems x[%-.1s>\magic/filesystemsx].%-.3s>^+x_%-.5s>`magic/filesystemsxa%-.2s>bmagic/filesystems xc%-.1s>dmagic/filesystemsxe.%-.3s>fmagic/filesystems=gKein System oder magic/filesystems=hLaufwerksfehlermagic/filesystems=iWechseln und Taste drcken, Microsoft DOS Bootloader (german)xk %-.2s>lmagic/filesystemsxm%-.6s>nmagic/filesystemsxo.%-.3s>q+xr%-.5s>smagic/filesystems xt%-.3s>umagic/filesystemsxv.%-.3s=xx)Non-System disk or magic/filesystems= y)disk error magic/filesystems= z)Replace and magic/filesystems={)press ,=|)strike , old=})any key when ready MS or PC-DOS bootloader=magic/filesystemsx %-.2s>magic/filesystemsx%-.4s >magic/filesystems x%-.2s>.x%-.3s> +x%-.5s>magic/filesystems x%-.1s >magic/filesystems x%-.2s>.x%-.3s=Cannot load from harddisk. magic/filesystems=Insert Systemdisk magic/filesystems=and press any key. , MS (2.11) DOS bootloader=6SYSmagic/filesystems=DVASKKmagic/filesystems=NEWLDR, DR-DOS Bootloader (LOADER.SYS)=bPress a key to retry magic/filesystems=xCannot find file magic/filesystems=Disk read error magic/filesystems= Loading ..., DR-DOS (3.41) Bootloader>,magic/filesystemsx, %-.6s>2magic/filesystemsx2%-.2s>4magic/filesystemsx4.%-.3s= FIBMBIO COMmagic/filesystems=Cannot load DOS! magic/filesystems=Any key to retry, DR-DOS Bootloader=Cannot load DOS magic/filesystems=press key to retry, Open-DOS Bootloader= KERNEL SYSmagic/filesystems= :BOOT error!, FREE-DOS Bootloader= KERNEL SYSmagic/filesystems= 1BOOT err!, Free-DOS Bootloader= KERNEL SYSmagic/filesystems= ?BOOT error!, FREE-DOS 0.5 Bootloader=Loading FreeDOSmagic/filesystems> , FREE-DOS 0.95,1.0 Bootloader>magic/filesystemsx %-.6s>magic/filesystemsx%-.1s>magic/filesystemsx%-.1s>magic/filesystemsx.%-.3s=KError!.0, FREE-DOS 1.0 bootloader=}Loading FreeDOS... magic/filesystems= 7BOOT error! , FREE-DOS bootloader>magic/filesystemsx %-.6s>magic/filesystemsx%-.1s>magic/filesystemsx%-.1s>magic/filesystemsx.%-.3s=|FreeDOSmagic/filesystems=K err, FREE-DOS BETa 0.9 Bootloader>magic/filesystemsx %-.6s>magic/filesystemsx%-.1s>magic/filesystemsx%-.1s>magic/filesystemsx.%-.3s=M err, FREE-DOS BEta 0.9 Bootloader>magic/filesystemsx %-.6s>magic/filesystemsx%-.1s>magic/filesystemsx%-.1s>magic/filesystemsx.%-.3s=N err, FREE-DOS Beta 0.9 Bootloader>magic/filesystemsx %-.6s>magic/filesystemsx%-.1s>magic/filesystemsx%-.1s>magic/filesystemsx.%-.3s=PError! magic/filesystems=WHit a key to reboot., FREE-DOS Beta 0.9sr1 Bootloader>magic/filesystemsx %-.6s>magic/filesystemsx%-.1s>magic/filesystemsx%-.1s>magic/filesystemsx.%-.3s= magic/filesystems=FI/O Error reading magic/filesystems=XVisopsys loader magic/filesystems=iPress any key to continue. , Visopsys loader>Mmagic/filesystems>Emagic/filesystems<Smagic/filesystems=BootProgmagic/filesystems>, COM/EXE Bootloader= .DOS-filenamemagic/filesystems=RENF, FAT (12 bit)= RENF, FAT (16 bit)=RRaAmagic/filesystems=rrAa, FSInfosector< , %u free clusters< , last allocated cluster %u=magic/filesystems=magic/filesystems>magic/filesystems=magic/filesystems=magic/filesystems< magic/filesystems=!, extended partition table=", extended partition table (LBA)=#, extended partition table (last)= 'WEV, BSD disklabel(=XXmagic/filesystems =؎1magic/filesystems=xNo operating system magic/filesystems=Disk error FDDHDDmagic/filesystems=  EBIOS AdvanceMAME mbr(=|Ў1magic/filesystemsx magic/filesystems= Error NetBSD mbr>,Serial %#-.8x=GZRR,bootselector=fff:2BZR,boot extended=07@,serial IO=jNo active partitionmagic/filesystems=Disk read errormagic/filesystems=No operating system,verbose=}ZR,CHS= TUAZR,LBA-check=&magic/filesystems= magic/filesystems=Error magic/filesystemsx,"%s"=.partition-tablemagic/filesystems(=magic/msdos!magic/msdos! magic/msdos= .msdos-drivermagic/msdos(=1@1magic/filesystems= NDTmbrmagic/filesystems=1234FTurton mbr (x %u<=x  Version<=%u= ,Y2K-Fix= ,TestDisk <  magic/filesystems!  ,%u/18 seconds<  ,floppy %#x >  magic/filesystems!  ,drive %#x >  magic/filesystems!  ,%u/18 seconds< ,floppy %#x > magic/filesystems! ,drive %#xx)(=|@|magic/filesystems= wISOLINUX isolinux Loaderx(version %-4.4s)(= magic/msdos= .msdos-drivermagic/msdos(=magic/msdos= . msdos-drivermagic/msdos(="zmagic/msdos= .#msdos-drivermagic/msdos(=%"magic/msdos= .&msdos-drivermagic/msdos(=magic/msdos= .msdos-drivermagic/msdos(=magic/msdos= .msdos-drivermagic/msdos(=2magic/msdos= .msdos-drivermagic/msdos(=magic/msdos= .msdos-drivermagic/msdos =TMR SEGAmagic/console=.sega-master-system-rom-headermagic/console =?TMR SEGAmagic/console=.?sega-master-system-rom-headermagic/console =TMR SEGAmagic/console=.sega-master-system-rom-headermagic/console = @Z@_CCFmagic/ccf= CCFPhilips Pronto IR remote control CCF = HDF  magic/images! MATLABHierarchical Data Format (version 5) with 512 bytes user blockapplication/x-hdf5h5/hdf5/hdf/he5 =>@BSDIFF40magic/diff!@bsdiff(1) patch fileapplication/x-bsdiffbsdiffx) M, at 0x20 = ࡱmagic/ole2compounddocs! OLE 2 Compound Document=, big-endian="jbjb: Microsoft Word Documentapplication/mswordMSWDWDBNdoc= magic/ole2compounddocsx , v%ux .%ux 0, SecID %#x! , exponent of short stream %u> ,!, %u FAT sectors! <$, Mini FAT start sector %#x! @&, %u Mini FAT sector> @(s! D+, DIFAT start sector %#x> H-, %u DIFAT sectors> 05too big for FILE_BYTES_MAX = 1 MiB= 7 , blocksize 4096 x 09magic/ole2compounddocs=.:ole2-directorymagic/ole2compounddocs= < magic/ole2compounddocs x 0?magic/ole2compounddocs=.@ole2-directorymagic/ole2compounddocs = BACKUP magic/msdos=  magic/msdosx  DOS 3.3 backup control file, sequence %d= , last disk =Rvhdxfilemagic/virtual=TheadMicrosoft Disk Image eXtendedvhdxxY, by %.256sx], sequence %#llx>0e, log id %#llxx8f-%llx> @h, LogVersion %#x! Bj, Version %#x> Dl, LogLength %u MB!Hn, LogOffset %#llx! Hploge, NO Log Signature= Hqloge; LOG> Hu, EntryLength %u KB! H}, Reserved %#x! regiMicrosoft Disk Image Extended, 1st region INVALID= regiMicrosoft Disk Image Extended; regionx , %u entries=.vhdx-idmagic/virtualx , at %#llxx ,, Required %u=.0vhdx-idmagic/virtualx@, at %#llxx L, Required %u! regi, 2nd region INVALID =WLPWMmagic/windows= .wim-archivemagic/windows =WIIDISCmagic/console=magic/console=T=3Nintendo GameCube disc image (WDFv1 format):application/x-gamecube-rom=.8nintendo-gcn-disc-commonmagic/console=X]Nintendo Wii disc image (WDFv1 format):application/x-wii-rom=.8 nintendo-gcn-disc-commonmagic/console= magic/console=  =3Nintendo GameCube disc image (WDFv2 format):application/x-gamecube-rom=. nintendo-gcn-disc-commonmagic/console= ]Nintendo Wii disc image (WDFv2 format):application/x-wii-rom=. nintendo-gcn-disc-commonmagic/console =?SSHKRL magic/ssh=@OpenSSH key/certificate revocation list, format %ux A, version %llxxB, generated %s =RPGMVmagic/games= magic/gamesxRPG Maker MV encrypted asset, version %08xpng_/ogg_/m4a_/rpgmvp/rpgmvo/rpgmvm =MSWIMmagic/windows= .wim-archivemagic/windows =LPKSHHRHmagic/linux=magic/linux>magic/linux> magic/linux>(magic/linux>0magic/linux>8magic/linux>@Journal fileapplication/x-linux-journal!@B, %s=empty=, =offlinejournal~ !offlinejournal/journal~=, =onlinejournal~ !onlinejournal=, archivedjournal= , sealed= , compressed! , compressed lz4! , keyed hash siphash24! , compressed zstd! , compact!X, header size %#llx>, entries %#llx =EESchemamagic/kicad= magic/kicad=  Schematicmagic/kicad= KiCad Schematic Document (Legacy)sch/bak=Versionmagic/kicad= magic/kicadx (Version %s) =^ AT&TFORMmagic/images= _ DJVMDjVu multiple page documentimage/vnd.djvu= a DJVUDjVu image or single page documentimage/vnd.djvu= c DJVIDjVu shared documentimage/vnd.djvu= e THUMDjVu page thumbnailsimage/vnd.djvu =1 line,! ?%d lines,= @1 position! A%d positions= BDigital Symphony pattern data (RISC OS),xCversion %d,= D1 pattern! E%d patterns =Ji'magic/apple==ڊApple ][ QBoot Image==ڊApple ][ 0Boot Image =magic/hardwarex magic/hardwarex EDID data, version %u.x %u =Dmagic/consolexAnalogue Pocket ROM imageapplication/x-analogue-pocket-rom= .gameboy-titlemagic/console=.gameboy-machine-typemagic/console=.Ggameboy-mappermagic/console=.Hgameboy-rom-sizemagic/console=.Igameboy-ram-sizemagic/console = ffmagic/console=CGame Boy Color ROM imageapplication/x-gameboy-color-rom!CGame Boy ROM imageapplication/x-gameboy-rom= .gameboy-titlemagic/console=.gameboy-machine-typemagic/console=.Ggameboy-mappermagic/console=.Hgameboy-rom-sizemagic/console=.Igameboy-ram-sizemagic/console =magic/lammps=DUMPATOMLAMMPS atom style binary dumpx(rev %d),= Big Endian,xFirst time step: %lld =)magic/lammps= *DUMPCUSTOMLAMMPS custom style binary dumpx+(rev %d),= ,Big Endian,x-First time step: %lld =vmagic/apt< APT cache data, version %ux .%u, 64 bit big-endian=.apt-cache-64bit-bemagic/apt =^I7 طmagic/animation=_^NWindows Television DVR Media =magic/linux=ƅsNEʂeHmBCache=cache device=backing device=cache device=backing device>H0, label "%.32s"x(, uuid %08xx,-%04xx.-%04xx0-%04xx2-%08xx6%04xx8, set uuid %08xx<-%04xx>-%04xx@-%04xxB-%08xxF%04x =magic/lammps=DUMPATOMLAMMPS atom style binary dumpx(rev %d),= Little Endian,xFirst time step: %lld ="magic/lammps= #DUMPCUSTOMLAMMPS custom style binary dumpx $(rev %d),= %Little Endian,x&First time step: %lld =!vmagic/apt< " APT cache data, version %ux #.%u, 64 bit little-endian=.$^apt-cache-64bit-bemagic/apt=W$uGLevelDB table data@= Subject:news or mail textmessage/rfc822@= #! rnewsbatched news textmessage/rfc822@= # Magic magic text file for file(1) cmdtext/x-file/(=Z OTOHPMWJPEG-XR Image=b , hard tiling=c , tiling present=c @@, codestream presentxc 8, spatial xform==c 8TL=c 8BL=c 8TR=c 8BR=c 8 BT=c 8(RB=c 80LT=c 88LB=d , short headerxf , %dxh x%d=d , long headerxf , %xxj x%xxe , bitdepth==e 1-WHITE=1=e 8=e 16=e 16-SIGNED=e 16-FLOAT=e (reserved 5)=e 32-SIGNED=e 32-FLOAT=e 5=e  10=e  5-6-5=e  (reserved %d)=e  (reserved %d)=e  (reserved %d)=e (reserved %d)=e 1-BLACK=1xe , colorfmt==e YONLY=e YUV240=e YWV422=e 0YWV444=e @CMYK=e PCMYKDIRECT=e `NCOMPONENT=e pRGB=e RGBE>e (reserved %#x)(= 0HD44DOS help fileapplication/x-4dos-hlphlpx% , version %-1.1s=' .x( %-2.2sx+ %-.2s=- .x. %-2.2s>3 55magic/msdosx G , external help %sx &I or specified by DOS environment variable %s(=AGarmin Voice Processing Module (encrypted)audio/x-vpm-garminvpm(= x%Foxit add-on/updateapplication/x-fzipfzip(=[ $Acronis True Image backupapplication/x-acronis-tibtib(=S LN:MS Advisor help fileapplication/x-ms-hlphlp(=10RMMAHAMMER filesystem (little-endian),x volume %dx (of %d),xPname %s,x version %u,x flags %#x(= 2MAHHAMMER2 filesystem (little-endian),x;volume %d,x(@size %lluGB,x 0version %u,x 4flags %#x =\ PLOT%%84Plot84 plotting file=4 , Little-endian=7, Big-endian =A PNTGMPNTMacPaint image data =@_BHRfS_MBTRFS Filesystem>+label "%s",x sectorsize %d,x nodesize %d,x leafsize %d,x UUID=%08x-x$%04x-x&%04x-x(%04x-x*%04xx,%08x,xx%lld/xp%lld bytes used,x%lld devices =<UvIMGViewFireViewer/ImageViewer PalmOS document>V"%s" =<udataTDBPThinkDB PalmOS document>v"%s" =<yToRaTRPWTomeRaider PalmOS document>z"%s" =<[ToGoToGoiSilo PalmOS document>\"%s" =<wTdatTideTides PalmOS document>x"%s" =<mTEXtTlDcTealDoc PalmOS document>n"%s" =<JTEXtREAdAportisDoc/PalmDOC E-book>K"%s"= .Laportisdocmagic/palm =<kSM01SMemSuperMemo PalmOS document>l"%s" =<4SDocSilXiSiloX E-book>5"%s" =<WPmDBPmDBHanDBase PalmOS document>X"%s" =<ePNRdPPrsPeanutPress PalmOS document>f"%s" =<cMdb1Mdb1MobileDB PalmOS document>d"%s" =<_JfDbJFilJFile Pro PalmOS document>`"%s" =<]JfDbJBasJFile PalmOS document>^"%s" =<oInfoTlIfTealInfo PalmOS document>p"%s" =<YInfoINDBInfoView PalmOS document>Z"%s" =<sDataTlPtTealPaint PalmOS document>t"%s" =<qDataTlMlTealMeal PalmOS document>r"%s" =<iDataSprdQuickSheet PalmOS document>j"%s" =<gDataPlkrPlucker PalmOS document>h"%s" =<SDB99DBOSDB PalmOS document>T"%s" =<aDATALSdbList PalmOS document>b"%s" =<QBVokBDICBDicty PalmOS document>R"%s" =<9BOOKMOBIMobipocket E-bookapplication/x-mobipocket-ebookxNBmagic/palm>PC"%s"= .Daportisdocmagic/palm>NhE, version %d!NF, codepage %d>N G, encrypted (type %d) =<BOOKMOBIMobipocket E-book>"%s" =4 ReIsErFsReiserFS V3.5 = ORCLDISKOracle ASM Volume,x(Disk Name: %0.12s = ORCLCLRDOracle ASM Volume (cleared),x(Disk Name: %0.12s =j@LVM2 001LVM2 PV (Linux Logical Volume Manager)=.  klvm2magic/linux =g@LVM2 001LVM2 PV (Linux Logical Volume Manager)=.  hlvm2magic/linux =a@LVM2 001LVM2 PV (Linux Logical Volume Manager)=.  blvm2magic/linux =d@LVM2 001LVM2 PV (Linux Logical Volume Manager)=.  elvm2magic/linux =!Scream!ScreamTracker Module sound data>Title: "%s" =!SCREAM!Screamtracker 2 module sound dataaudio/x-mod =BMOD2STMScreamtracker 2 module sound dataaudio/x-mod =qSCPECGBiosig/SCP-ECG format CEN 1064:2005/ISO 11073:91064biosig/scpecg = DrawFileIslandDraw document = vGERBILDBFirst Choice database =E˺ZFS snapshot (little-endian machine),x Fversion %u,= Gtype: NONE,= Htype: META,= Itype: ZFS,= Jtype: ZVOL,= Ktype: OTHER,= Ltype: ANY,> Mtype: UNKNOWN (%u),x/Ndestination GUID: %02Xx.O%02Xx-P%02Xx,Q%02Xx+R%02Xx*S%02Xx)T%02Xx(U%02X,>0Vmagic/zfs>4Wmagic/zfsx7Xsource GUID: %02Xx6Y%02Xx5Z%02Xx4[%02Xx3\%02Xx2]%02Xx1^%02Xx0_%02X,>8`name: '%s' =MayaFOR4Alias Maya Binary File,> version %s scene =MAYAFOR4Alias Maya Binary File,> version %s scene ='ˬZFS snapshot (big-endian machine),x(version %u,= )type: NONE,= *type: META,= +type: ZFS,= ,type: ZVOL,= -type: OTHER,= .type: ANY,> /type: UNKNOWN (%u),x(0destination GUID: %02Xx)1%02Xx*2%02Xx+3%02Xx,4%02Xx-5%02Xx.6%02Xx/7%02X,>08magic/zfs>49magic/zfsx0:source GUID: %02Xx1;%02Xx2<%02Xx3=%02Xx4>%02Xx5?%02Xx6@%02Xx7A%02X,>8Bname: '%s' =ni2  NIfTI-2 neuroimaging data header,image/x.niftihdr=.nifti2magic/nifty =n+2  NIfTI-2 neuroimaging data,image/x.niftinii=.nifti2magic/nifty =gtktalogGNOME Catalogue (gtktalog)> version %s =.WINIMAGEWinImage archive data = HDF  Hierarchical Data Format (version 5) with 4k user blockapplication/x-hdf5h5/hdf5/hdf/he5 = HDF  Hierarchical Data Format (version 5) with 2k user blockapplication/x-hdf5h5/hdf5/hdf/he5 = HDF  Hierarchical Data Format (version 5) with 1k user blockapplication/x-hdf5h5/hdf5/hdf/he5 =@WordProLotus WordProapplication/vnd.lotus-wordpro =g @MSCFMicrosoft Cabinet archive data=,n .diag, Diagnosticapplication/vnd.ms-cab-compresseddiagcab=,t ,png.pub, Publisher Packed and Goapplication/vnd.ms-cab-compressedpuz= ,x ppview32.exe, PowerPoint Viewer Packed and Goapplication/vnd.ms-powerpointppz= , gadget.xml, Windows Desktop Gadgetapplication/x-windows-gadgetgadget= , ) content.ini, IncrediMailapplication/x-incredimail= , SFlavor.htmecardimf=, .swfskinims= , \anim.im3animationimax, magic/msdos=, tthumbecard, image, notifier or skinimf/imi/imn/imsx, emoticons or soundime/imwx, magic/msdos x  magic/msdos= PackageInfo.xml, Device Metadata Packageapplication/vnd.ms-cab-compresseddevicemetadata-ms=  _accrpt_.snp, Access report snapshotapplication/msaccesssnp=  manifest.xsf, InfoPath Form Templateapplication/vnd.ms-cab-compressedxsn= .000, WinCE installapplication/vnd.ms-cab-compressedcab=  wsusscan.cab, Microsoft Standalone Updateapplication/vnd.ms-cab-compressedmsux magic/msdos= .magic/msdos= pptmagic/msdos>  , PowerPoint Packed and Goapplication/vnd.ms-powerpointppz=  , one packed PowerPointapplication/vnd.ms-cab-compressedpp_= theme, Windowsapplication/x-windows-themepack=  Panoram8deskthemepack!  Panoram7 or 8themepack/deskthemepack x  Theme Pack= one, OneNote Packageapplication/msonenoteonepkgx magic/msdos= magic/msdos=  wsusscan.cab, Microsoft Standalone Updateapplication/vnd.ms-cab-compressedmsux magic/msdos>  , manyapplication/vnd.ms-cab-compressedcab=  magic/msdos =  , Windows 2000/XP setupapplication/vnd.ms-cab-compressed_/?_/??_ !  , singleapplication/vnd.ms-cab-compressedcabx magic/msdos=  , singleapplication/vnd.ms-cab-compressed_>  , manyapplication/vnd.ms-cab-compressedcabx  , %u bytes=  , 1 file>  , %u filesx  , at %#x=.  cab-filemagic/msdos>  magic/msdos x  magic/msdos= magic/msdos=. cab-filemagic/msdos!  version %#x>  , %u cffolders>  , flags %#x>  , ID %ux " , number %u& ! , extra bytes> $# %u in head>&% %u in folder>'' %u in data block> $) magic/msdos= . $(+ cab-foldermagic/msdos^ - magic/msdos= / magic/msdos= .$0 cab-foldermagic/msdos= 2 , previous= .$3 cab-anchormagic/msdos= 5 , next= .$6 cab-anchormagic/msdos= ; , previousx$< %sx> disk %sx? , next %sxA disk %s= .B cab-foldermagic/msdos = @MSCEMicrosoft WinCE install header=  , architecture-independent=  g, Hitachi SH3=  h, Hitachi SH4=   , StrongARM=  , MIPS R4000=  ', Hitachi SH3=  ', Hitachi SH3E=  ', Hitachi SH4=  q, ARM 7TDMI= 4 , 1 file> 4 , %u files= 8 , 1 registry entry> 8 , %u registry entries =@MAKI02 Maki-chan v2 image,xsystem ID: %cx %cx %cx %c,= magic/pc98 =+D256x212, 19268 fixed YJK colors !,Dmagic/pc98 x -%dxx .%d, =/16 paletted RGB colors =08 paletted RGB colors =116 fixed RGB colors =28 fixed RGB colors =3256 paletted RGB colors =4256 fixed MSX-SCR8 colors=5, 2:1 dot aspect ratio = @ITOLITLSMicrosoft Reader eBook Datax  , version %uapplication/x-ms-reader =U@GBSDIF42Courgette binary diff outputapplication/x-patchpatch/bsdiffx \, crc %#8.8x = @DDS |Microsoft DirectDraw Surface (DDS):=. ms-directdraw-surfacemagic/images =@޺}tMSX cassette archive =@ Microsoft Excel Worksheetapplication/vnd.ms-excelXCELXLS4xls =@8tz3 ms-works file =@8tz3 ms-works file =@8tz3 ms-works file =OS/2 INIapplication/x-os2-iniini ==MKMSGFOS/2 help messageapplication/x-os2-msgmsgxA'%.3s'x C, %u messages> E, 1st number %u=G, 32-bit! J, version %u> Lmagic/os2! M, at %#x index=Omagic/os2x Q, at %#xx U%c-typexV%s=Xmagic/os2x Z, number %u x \at %#xx ^%c-type =` magic/os2xa%s !b magic/os2xc%s= emagic/os2=fmagic/os2x h, at %#x x j%c-typexk%sx !m, at %#x x !n%c-typexo%sx #q, at %#x x #r%c-typexs%s=umagic/os2x w, at %#x x x%c-typexy%sx #{, at %#x x #|%c-typex}%sx ', AT %#x x '%c-typex%s! , at %#x countryinfo> , at %#x next! , RESERVED %#x = . os2-msg-infomagic/os2 =*BIOSEMIBiosig/Biosemi data formatbiosig/bdf =PBC  Parrot bytecodex@ %d.xH %d,> %d byte words,= little-endian,= big-endian,= IEEE-754 8 byte double floats,= x86 12 byte long double floats,= IEEE-754 16 byte long double floats,= MIPS 16 byte long double floats,= AIX 16 byte long double floats,= 4-byte floats,x(Parrot %d.x0%d.x8%d =_ cSQLite Rollback Journal =:@z/OS Program Object executable ={@_w PAQ archive data = HDF  Hierarchical Data Format (version 5) dataapplication/x-hdf5h5/hdf5/hdf/he5 =xFSdump0xfsdump archivex(version %d) =v`rpmsg Restricted Permission Message =ssh-rsa OpenSSH RSA public keytext/x-ssh-public-keypub =ssh-dss OpenSSH DSA public keytext/x-ssh-public-keypub =qv4cdataQV4 compiled unitqmlcx , version %dx , Qt %dx .%dx.%d =qpress10qpress compressed dataapplication/x-qpress =pl_cachelibplacebo cachex , version %u= , empty= , 1 entry> , %u entries=, version 3.00.00=, version 3.03.00=, version 4.00.00=, version 4.02.00=, version 5.00.00 =package4Newton package,=NOS 1.x,= NOS 2.x,& AutoRemove,& @CopyProtect,& NoCompression, = package1Newton package, NOS 2.x,& AutoRemove,& @CopyProtect,& NoCompression,& Relocation,& UseFasterCompression,xversion %d =package0Newton package, NOS 1.x,& AutoRemove,& @CopyProtect,& NoCompression,& Relocation,& UseFasterCompression,x version %d =msgcat01HP NLS message catalog,>%d messages =Umpu401trMPU-401 Trakker =mozLz40Mozilla lz4 compressed dataapplication/x-lz4+jsonjsonlz4/mozlz4x , originally %u bytes =5hopperdbHopper database =gimp xcfGIMP XCF image data,image/x-xcfxcf= fileversion 0,= vversion> !%s,x"%u xx#%u,=$RGB Color=%Greyscale=&Indexed Color>'Unknown Image Type. = farbfeldfarbfeld image data,x %dxx %d =Me]TSComp archiveapplication/x-tscomp-compressed=Rdata, filename style 0??$=Vdata??$/??!=Ydata, with wildcard/lib/cmp/$$$/tsc/pakx ], %sx6_, modified %sx9`%sx b, compressed size %u> imagic/archivex k, %s ... =cyd!songKlystrack song>, version %u>magic/audiox , title %s =cyd!instKlystrack instrument = conectixMicrosoft Disk Image, Virtual Server or Virtual PCapplication/x-virtualbox-vhdvhdx!, Creator %-4.4sx $%xx"%.%xx$((=$)k2iWW2k=$* caMMacx$+0xx$,%8.8xx .Cm8) %sx03, %llu bytesx86, CHS %ux:9/%ux;</%u!<>, type %#x!TE, State %#x =btsnoopBTSnoopxversion %d,= Unencapsulated HCI= HCI UART (H4)= HCI BCSP= HCI Serial (H5)x type %d =bplist00Apple binary property listapplication/x-bplist =EZXTape!Spectrum .TZX dataapplication/x-spectrum-tzxtzx/cdtxJversion %dx K.%dx M; ID %#x= O(turbo)x Q, %u pilot pulsesx Swith %u tstatesx U, %u andx W%u sync tstatesx Y, %u zero tstatesx [, %u one tstatesx], use %u bit>_sx a, %u ms pausex c, %u data bytes = d (pause)x f%u ms= h0(text)x k"%s"= m2(archive info)x o, %#x bytesx qwith %u (type) text parts<s (%d)>tmagic/spectrumx w%s<y (%d)>zmagic/spectrumx {%s<} (%d) >~magic/spectrum x %s < (%d) >magic/spectrum x %s< (%d)>magic/spectrumx %s< (%d)>magic/spectrumx %s< (%d)>magic/spectrumx %s =hZXAYEMULSpectrum 128 tune =7WNGZWZSSWingz spreadsheet =6WNGZWZSCWingz compiled script =8WNGZWZHPWingz help file =TDB fileTDB database= m&version 6, little-endianx $hash size %d bytes =!Synth4.0Synthesis Module sound file =&Salted__openssl enc'd data with salted password =SX961999Net2phone =SINCLAIRSpectrum .SCL Betadisk image =2SGIAUDITSGI Audit filex3- version %dx 4.%d =SCRSHOT_scrshot(1) screenshot,xversion %d,= %d bytes in header,x %d chars wide byx %d chars high =dSB2100PRSeaBeam 2100 PR multibeam sonar =cSB2100DRSeaBeam 2100 DR multibeam sonar =Rar!RAR archive data, v5application/vnd.rarrar =ORAWADATARdosPlay RAW = PXR-USDCUSD cratex , version %x.x %x.x %xusd =)PS-X EXESony Playstation executablex *PC=%#08x,! +GP=%#08x,! ,.text=[%#08x,x -%#x],! ..data=[%#08x,x $/%#x],! (0.bss=[%#08x,x ,1%#x],! 02Stack=%#08x,= 03No Stack!,! 44StackSize=%#x,xq7(%s) =POLYSAVEPoly/ML saved statexversion %u =POLYMODUPoly/ML saved modulexversion %u =PNCIUNDONorton Disk Doctor UnDo file =A PK00PKZip archive dataapplication/zipzip/cbz =PKPKZip multi-volume archive data, at least PKZIP v2.50 to extractapplication/zipzip/cbz =PERFFILELinux perf recording, version 1 =[PCPFolioPCP= \Version:Archive Folio>](V.%s) =PBLAPPPebble application =ORICDISKOric Image =OKTASONGOktalyzer module data =NqNqNq`QL firmware executable (BCPL) =NJPL1I00PDS (JPL) image data =cNEURALEVBiosig/NEV = Maestro RISC OS music filex!version %dx#type %d =}MSFTType Library (MSFT format) =MODINFO1Open Cubic Player Module Information MDZ =MFM_DISKOric Image =MComprHDMAME CHD compressed hard disk image,x version %u =MAMEINPMAME input recordingxat %s,x format version %d.x %d,x %s driver,x %s = LBLSIZE=VICAR image data= BYTE, 8 bits = VAX byte= HALF, 16 bits = VAX word = Fortran INTEGER*2= FULL, 32 bits = VAX longword = Fortran INTEGER*4= REAL, 32 bits = VAX longword = Fortran REAL*4= DOUB, 64 bits = VAX quadword = Fortran REAL*8= COMPLEX, 64 bits = VAX quadword = Fortran COMPLEX*8 =LBLSIZE=PDS (VICAR) image data =0LAMMPS (LAMMPS log file=1[0-9]+ [A-Za-z]+ [0-9]+written by version %s = LRFBBeB ebook data, unencryptedx , version %d=$ , front-to-back=$ , back-to-frontx* , (%dx,x, %d) = KGB_archKGB Archiver filex with compression level %.1s =KDUMP Kdump compressed dump=.kdump-compressed-dumpmagic/linux =JGAOL ART image =JGAOL ART image =[ISHNE1.0Biosig/ISHNEbiosig/ishne = HDMV0100AVCHD Clip Information =.GVariantGVariant Database file,x 0version %d =GRUBLAYOGRUB Keyboardapplication/x-grub-keyboardgkb!  , version %u!\qmagic/linux>\@, english q is %c!|ymagic/linux>|@, english y is %c =GOOF----Guile Object=LE, little endian=BE, big endian= 4, 32bit= 8, 64bit= .\.., bytecode v%s =DGNU tar-GNU tar incremental snapshot data=E[0-9]\.[0-9]+-[0-9]+version %s =GCR-1541GCR Imagexversion: %ix tracks: %i =ElfFileMS Windowsapplication/x-ms-evtxevtx= $Vista-8.1 Event Log! $10-11 Event Log, version x & %ux $ .%ux * , %d chunksx   (no. %d in use)>  , next record no. %d= , empty& x, DIRTY& x, FULL = EVF EWF/Expert Witness/EnCase image file format =ESTFBINREST flat binary =EFI PARTGPT data structure (nonstandard: at LBA 0)= .gpt-tablemagic/gptx(sector size unknown) =KEBS  Biosig/EBSbiosig/ebs =E2UNDO02e2fsck undo file, version 2x ,, undo file is= ,not finished= ,finishedx 0, undo file features:= 0lacks filesystem offset= 0has filesystem offsetx@at %#llx ==DATABiosig/Heka Patchmaster =?DAT2Biosig/Heka Patchmasterbiosig/heka =>DAT1Biosig/Heka Patchmaster =DAAPowerISO Direct-Access-Archive =CgWebshots Desktop .wbz file =.CrshDumpIRIX vmcore dump of>$/'%s' =Caml1999OCaml=Xexec file=Iinterface file (.cmi)=Oobject file (.cmo)= Alibrary file (.cma)= Ynative object file (.cmx)= Znative library file (.cmxa)= Mabstract syntax tree implementation file= Nabstract syntax tree interface file> (Version %3.3s) =CPQRFBLOCompaq/HP RILOE floppy image = CKD_S370Hercules CKD DASD shadow file=. HercCKDmagic/images = CKD_S064Hercules CKD64 DASD shadow file=. HercCKDmagic/images =CKD_P370Hercules CKD DASD image file=.HercCKDmagic/images = CKD_P064Hercules CKD64 DASD image file=. HercCKDmagic/images =CKD_C370Hercules compressed CKD DASD image file=.HercCKDmagic/imagesx (, %d total cylinders=- , no compression=- , ZLIB compression=- , BZ2 compression = CKD_C064Hercules compressed CKD64 DASD image file=. HercCKDmagic/imagesx  , %d total cylinders=I , no compression=I , ZLIB compression=I , BZ2 compression =ECFWBBiosig/CFWBbiosig/cfwb =CBMDNintendo 3DS Banner Model Data =CAR 2.01SAPCAR archive dataapplication/vnd.sarsar =CAR 2.00SAPCAR archive data =C64ImagePC64 Freezer Image =CRBLCR= x86= alpha= x86-64= ARMx context data (little endian, version %d) =B4f"RADCOM WAN/LAN Analyzer capture file =BOMStoreMac OS X bill of materials (BOM) file =&BCI2000VBiosig/BCI2000biosig/bci2000 =jArchiveRISC OS archive (ArcFS format) =RASTM-E57ASTM E57 three-dimensional modelmodel/e57e57 =SARMovie ARMovie =ANDROID!Android bootimg=LOKI, LOKI'd=  (boot)=  (recovery)> , kernel>  (%#x)> , ramdisk>  (%#x)> , second stage>  (%#x)> $ , page size: %d>&!0, name: %s>@"0, cmdline (%s) =AMOS ProAMOS Basic source code= V, tested= v, untested =AMANDA: AMANDA=TAPESTART DATEtape header file,=Xmagic/amanda> Unused %s> DATE %s= FILE dump file,> DATE %s =ADRVPACKAProSys module =_@ MFER Biosig/MFER =6(%.3s= @>)! A>%c)= C#magic/framexD"%s" =0;; HSF VOpenHSF (Hoops Stream Format)= 1 V[.0-9]{4,5} %shsf =5 DOMINOQuake I save: ddm6 Domino =o5 Area44Quake I save: d1c Area 44 =0xabcdefAIX message catalog =60 Biosig/EDF: European Data formatbiosig/edf =-rom1fs-romfs filesystem, version 1x%d bytes,xnamed %s. =**TIFL**TI-XX Graphing Calculator (FLASH)>- Revision %dx .%d,> Revision date %02xx /%02xx/%04x,>/0name: '%s',=0tdevice: TI-73,=0sdevice: TI-83+,=0device: TI-89,=0device: TI-92+,=1#type: OS upgrade,=1$type: application,=1%type: certificate,=1>type: license,> Jsize: %d bytes =**TI92P*TI-92+/V200 Graphing Calculator=H(expression)=H(list)=H(matrix)=H (data)=H (text)=H (string)=H (graphic data base)=H(figure)=H(picture)=H(program)=H(function)=H(macro)=H(zipped)=H!(assembler) =**TI92**TI-92 Graphing Calculator=H(expression)=H(list)=H(matrix)=H (data)=H (text)=H (string)=H (graphic data base)=H(figure)=H(picture)=H(program)=H(function)=H(macro)=H(backup) =**TI89**TI-89 Graphing Calculator=H(expression)=H(list)=H(matrix)=H (data)=H (text)=H (string)=H (graphic data base)=H(figure)=H(picture)=H(program)=H(function)=H(macro)=H(zipped)=H!(assembler) =}**TI86**TI-86 Graphing Calculator=;~(real number)=;(complex number)=;(real vector)=;(complex vector)=;(real list)=;(complex list)=;(real matrix)=;(complex matrix)=;(real constant)=; (complex constant)=; (equation)=; (string)=; (function GDB)=;(polar GDB)=;(parametric GDB)=;(diffeq GDB)=;(picture)=;(program)=;(range)=;(window settings)=;(window settings)=;(window settings)=;(window settings)=;(zoom)=;(backup)=;(unknown)=;*(equation) =\**TI85**TI-85 Graphing Calculator=;](real number)=;^(complex number)=;_(real vector)=;`(complex vector)=;a(real list)=;b(complex list)=;c(real matrix)=;d(complex matrix)=;e(real constant)=;f (complex constant)=;g (equation)=;h (string)=;i (function GDB)=;j(polar GDB)=;k(parametric GDB)=;l(diffeq GDB)=;m(picture)=;n(program)=;o(range)=;p(window settings)=;q(window settings)=;r(window settings)=;s(window settings)=;t(zoom)=;u(backup)=;v(unknown)=;w*(equation)=2xZS4- ZShell Version 4 File.=2yZS3- ZShell Version 3 File. =G**TI83F*TI-83+ Graphing Calculator=;H(real number)=;I(list)=;J(matrix)=;K(equation)=;L(string)=;M(program)=;N(assembly program)=;O(picture)=;P(gdb)=;Q (complex number)=;R(window settings)=;S(zoom)=;T(table setup)=;U(backup)=;V(application variable)=;W(group of variable) =5**TI83**TI-83 Graphing Calculator=;6(real)=;7(list)=;8(matrix)=;9(Y-variable)=;:(string)=;;(program)=;<(protected prgm)=;=(picture)=;>(gdb)=;? (window settings)=;@ (window settings)=;A (table setup)=;B(screenshot)=;C(backup) =$**TI82**TI-82 Graphing Calculator=;%(real)=;&(list)=;'(matrix)=;((Y-variable)=;)(program)=;*(protected prgm)=;+(picture)=;,(gdb)=;- (window settings)=;. (window settings)=;/ (table setup)=;0(screenshot)=;1(backup) =**TI81**TI-81 Graphing Calculator File. = **TI80**TI-80 Graphing Calculator File. =**TI73**TI-73 Graphing Calculator=;(real number)=;(list)=;(matrix)=;(equation)=;(string)=;(program)=;(assembly program)=;(picture)=;(gdb)=; (complex number)=;(window settings)=;(zoom)=;(table setup)=; (backup) = %bitmapFBM image data= 1, mono= 3, color = %XDZ004%XDelta binary patch file 1.1 = %XDZ003%XDelta binary patch file 1.0.4 = %XDZ002%XDelta binary patch file 1.0 =%XDZ001%XDelta binary patch file 0.20 =%XDZ000%XDelta binary patch file 0.18 =%XDELTA%XDelta binary patch file 0.14 =^#pmchartPCP pmchart view= _Versionmagic/sgi>`(V%-3.3s) =a#kmchartPCP pmchart view= bVersionmagic/sgi>c(V.%s) =#OPL_II#DMX OP2 instrument data =#%Modulemodulefiletext/x-modulefile =B! thin archive with=DCno symbol entries=DD%d symbol entry>DE%d symbol entries ={!MKS Spell hash list (old format) =+! current ar archiveapplication/x-archivea/lib/ar= 2__.SYMDEFrandom library=D4__.SYMDEF SORTEDrandom library=D9 - PA-RISC1.0 relocatable library=D:- PA-RISC1.1 relocatable library=D;- PA-RISC1.2 relocatable library=D<- PA-RISC2.0 relocatable library =F!! profiling data file =iarchiveRISC OS archive (ArcFS format) =+ CAZIPCAZIP compressed fileapplication/x-compress-cazip??_/?_/_ =Qchibi Chibi-Scheme memory image data=R, big-endianx S, format version %dx T.%d>U, little-endianxV, format version %dx W.%dx X, ABI %s =# tClaris works dictionary =2 Digital Symphony song (RISC OS),x3version %d,= 41 voice,! 5%d voices,= 61 track,! 7%d tracks,= 81 pattern! 9%d patterns =' Digital Symphony sound sample (RISC OS),x(version %d,x )named "%s",= *8-bit logarithmic= +LZW-compressed linear= ,8-bit linear signed= -16-bit linear signed= .SigmaDelta-compressed linear= /SigmaDelta-compressed logarithmic> 0unknown format ==plocateplocate databaseapplication/x-plocatedb! C, version %u! G, extra_ht_slots %#x> I, num_docids %u> Omagic/linux! (Q, max version %u! ,S, at %#x>0U+%#llx x0Wmagic/linux x ,Zmagic/linuxx)] > (_magic/linux>He, next zstd dictionary length %#llx>Pgoffset %#llxxXi, configuration size %llu>`k, at %#llx 1st variablex`m%sxo=%s=hq, require visibility =#mlocatemlocate databaseapplication/x-mlocatedb! ), version %d= +, require visibilityx/, root %sx1, 1st variable %sx3=%sx5, configuration size %u = SMJPEGSMJPEGx%d.x data=_SND,>%d Hz=8-bit=16-bit=NONEuncompressed=mono=stereo= _VID,>(%d frames>,(%d x>.%d)=_VID,>%d frames>(%d x>%d) = ReFSReFS filesystem image =CRBLCR=SPARC=ppc=ppc64=ARMEB=SPARC64xcontext data (big endian, version %d) =pO`Nintendo DS Slot-2 ROM image (PassMe)application/x-nintendo-ds-rom =!iQ$Nintendo DS ROM imageapplication/x-nintendo-ds-rom>: "%.12s"x (%.6sx, Rev.%02u)=(DSi enhanced)=(DSi only)< @(homebrew)> ?magic/console=@(multiboot)!@magic/console=@(decrypted)!@magic/console= (encrypted)! (mask ROM) = hЭVulkan trace file, big-endianx, version %d =!iQ$Game Boy Advance ROM imageapplication/x-gba-rom>: "%.12s"x(%.6sx, Rev.%02u) =YlprofiLLVM indexed profile data,xZversion %d (big-endian) =MZ\Hash::SharedMem master file, big-endian<Nmagic/perl>O, line size 2^%d byte>P, page size 2^%d byte& Qmagic/perl> R, max fanout %d =ͫErlang DETS file =YG^ړHash::SharedMem data file, big-endian<Zmagic/perl>[, line size 2^%d byte>\, page size 2^%d byte& ]magic/perl> ^, max fanout %d =KrforplLLVM raw profile data,xLversion %d (big-endian) =PERFILE2Linux perf recording, version 2. big endian =LCUUCL compressed data =@7Nintendo 64 ROM imageapplication/x-n64-rom> : "%.20s"x;(%.4sx?, Rev.%02u) =bgfbgfFlatGeobuf file =fBurp project save file =@7Nintendo 64 ROM image (V64)application/x-n64-rom =7@Nintendo 64 ROM image (wordswapped)application/x-n64-rom =7@Nintendo 64 ROM image (32-bit byteswapped)application/x-n64-rom = hЭVulkan trace file, little-endianx , version %d =UlprofiLLVM indexed profile data,xVversion %d =SZ\Hash::SharedMem master file, little-endian<Tmagic/perl>U, line size 2^%d byte> V, page size 2^%d byte& Wmagic/perl> X, max fanout %d =DHermes JavaScript bytecodex E, version %d =_G^ړHash::SharedMem data file, little-endian<`magic/perl>a, line size 2^%d byte> b, page size 2^%d byte& cmagic/perl> d, max fanout %d =GrforplLLVM raw profile data,xHversion %d =PERFILE2Linux perf recording, version 2. little endian =Extended display identification data dumpapplication/x-edid-dump=Version 1< .%d= Version 2= .0@A=+P3magic/images= P3[ ]magic/images=.netpbmmagic/imagesx, pixmapimage/x-portable-pixmapppm@A=+P2magic/images= P2[ ]magic/images=.netpbmmagic/imagesx, greymapimage/x-portable-graymappgm@A=+P1magic/images=[ ]magic/images! 000000000magic/images=.netpbmmagic/imagesx, bitmapimage/x-portable-bitmappbm=#magic/imagesx%s A=+Umagic/filesystems< magic/filesystems =  UDOS/MBR boot sector= UDOS/MBR boot sector =+/* CTF Common Trace Format (CTF) plain text metadata=[0-9]+\.[0-9]+, v%s@=5+&^export (function|class|default|const|var|let|async) JavaScript sourceapplication/javascriptjs@=+@$WebVTT subtitlestext/vttvtt =8netbsdmagic/netbsd=.ktracemagic/netbsd =STTTmagic/images=.gem_infomagic/images =magic/filesystems= magic/filesystems=BOpenVMS backup saveset datax ((block size %d,>1original name '%s',=VAX generated)=AXP generated)=I64 generated) = magic/filesystems= magic/filesystems= magic/filesystems> magic/filesystemsx YAFFS filesystem root entry (big endian)=. ^yaffsmagic/filesystems =@ABmagic/msx> @MSX device BIOS> , devhdl=%#04x =qmagic/msdos= Stirling Technologies,InstallShield Uninstall Script =bplistmagic/applexCoreFoundation binary property list data, version %#cx%c=00magic/apple=magic/apple=, root type: null=, root type: false boolean= , root type: true boolean=, root type: integer= , root type: real=0, root type: date=@, root type: data=P, root type: ascii string=`, root type: unicode string=, root type: uid (CORRUPT)=, root type: array=, root type: dictionary =GARMINmagic/map= dGARMIN firmware (version 1.0) =DWARFSmagic/dwarfs=*@magic/dwarfs= DWARFSDwarFS File System Image= .dwarfsversionmagic/dwarfs=.dwarfscompressionmagic/dwarfs =qAUDIMGmagic/audio< s Garmin Voice Processing Moduleaudio/x-vpm-wav-garminvpmxw, version %3.3sx y, %.2dx {.%.2dx }.%.4dx %.2dx :%.2dx :%.2dx, language ID %d> magic/audio> , at %#x > %u bytes = RIFFmagic/audiox)magic/audio =' magic/apple=magic/applexApple DOS 3.%u Imagex, Volume #%03ux4, %u Tracksx5, %u Sectorsx 6, %u bytes per sector < ,DryadDatamagic/dataone=-dryad-bibo/v[0-9]\.[0-9]https://datadryad.org/profile/v3.1text/xml@= # xmcdxmcd database file for kscdtext/x-xmcd =0 SymExeSymbOS executablex6 v%cx7 .%cx , name: %s =7@FTCOMPFTCOMP compressed archiveapplication/x-compress-ftcomp??_/??@/dll/drv/pk2/!<, at beginning %#xx)>"%s" = kPLEXONBiosig/Plexon v2.0biosig/plexon =oOctSquSquash archive data =4IBM NETDATA file =NJPL1IPDS (JPL) image data =MMXPRaMotorola Quark Express Document (Korean) =MMXPR3Motorola Quark Express Document (English)application/x-quark-xpress-3 =IIXPRaIntel Quark Express Document (Korean) =IIXPR3Intel Quark Express Document (English) =CCSD3ZPDS (CCSD) image data =ADLIB-AdLib instrument datax, version %ux.%u =[licq]LICQ configuration file =M7R0 IMaple Vr7 libraryapplication/x-maple-liblibx %sx %, %u string> 'sx(1st '%s'!T- , at 0x454 0x%x =@ۥ-Microsoft Word 2.0 Documentapplication/msworddoc = @MAKI01Maki-chan v1.x %c image> @@@@, system ID:x %cx %cx %cx %cx,, %dxx.%d=&, 16 paletted RGB colors=&, 8 fixed RGB colors=&, 2:1 dot aspect ratio =0SOAtari GED bitmap, 160x200image/x-atari-gedged =¨MP¨KBoom archive data =IbGTA1 in-game text (FXT), =/NUMPYNumPy data fileapplication/x-numpy-datax1, version %dx2.%dx 4, description %s =NUMPYNumPy array,xversion %dx.%d,x  header length %d =SBBSArc/BS2 archive data = {titleChord text file =J{\urtfRich Text Format unicoded datatext/rtfrtf=.Nrtf-infomagic/rtf =v9.6GTA2 replay file (REP),= [a-z0-9: ]+created on %s =submscMessage Sequence Chart (subchart) =BrJLinux/i386 PC Screen Font v2 data,x C%d characters,= Dno directory,! EUnicode directory,x F%dx Gx%d = qresQt Binary Resource file =ptabPower-Tab v4 Tablature File =ptabPower-Tab v3 Tablature File =dpmviewPCP pmview config=eVersionmagic/sgi>f(V%-3.3s) =\ofTAZ!eXtra Simple Music =PiRivDBiRiver Database file> QVersion %s='RiHP-100[H Series] =fcscopecscope reference dataxgversion %.2s>l14magic/c-lang= md -q with inverted index= nd -c text (non-compressed) ='b0nanoNano swap file= .(vimnanoswapmagic/editors = b0VIM Vim swap file>!, version %s= ."vimnanoswapmagic/editors =avaobjAVR assembler object code>version '%s' = ZyXELZyXEL voice data= - CELP encoding= - ADPCM2 encoding=  - ADPCM3 encoding=  - ADPCM4 encoding=  - New ADPCM3 encoding= with resync = XARAXara graphics file ='X imprSoftQuad troff Context intermediate for IMAGEN imPRESS =iVCLMTFStarView MetaFilexj, version %dxk, size %d ="SymVidSymbOS videox#v%cx$.%c =bSB2100SeaBeam 2100 multibeam sonar =RuneCTCitrus locale declaration for LC_CTYPE =P7 332XV thumbnail image dataimage/x-xv-thumbnailp7/gif/tif/xpm/jpg = NFlNuFile archive (apple ][) data = NuFileNuFile archive (apple ][) data =TNBCDB NetBSD Constant DatabasexU, version %dxV, for '%s'x W, datasize %dx X, entries %dx Y, index %dx $Z, seed %#x =dN.EV.Biosig/NEVbiosig/nev =MythTVMythTV NuppelVideox v%sx (%dx x%d),=$Pprogressive,=$Iinterlaced,x&(aspect:%.2f,x&0fps:%.2f = MIOPENMallard BASIC Jetsam data =OMBSTV MUIbase DBxPversion %s =ZMATLABMatlab vapplication/x-matlab-datamat=b55 mat-file!c5magic/mathematicaxd%.3s mat-file=~eMI(big endian)x|fversion %#04x=~gIM(little endian)x |iversion %#04xx~kmagic/mathematica= nPlatform: , platformxo%-0.2s!p,%c!q,%c!r,%c!s,%c!t,%c!u,%c !v,%cxxmagic/mathematicax y"%s"= "{ created on: , createdx|%-.24s = LUKSLUKS encrypted file,application/x-raw-disk-image/luks/img/luksVolumeHeaderBackUpxver %d=magic/luks=.luks-v1magic/luks>magic/luks=.luks-v2magic/luks =LM8953Yamaha TX Wave=Ilooped=non-looped=33kHz=50kHz=16kHz =LEOLZWPAKLeo archive data =>JIF99aJeffs Image Format dataimage/x-jif????JIFfjifx D%u xx E%u =INFOqSymbOS DOX document =tIAvSFoBiosig/SIGIFbiosig/sigif =3HSPOS/2 HLPapplication/x-os2-hlphlp>k60(%s) =/HSPOS/2 INFapplication/x-os2-infinf>k20(%s) =GIF94zZIF image (GIF+deflate alpha)image/x-unknown =xGERBILFirst Choice device file =GFOXSQZFoxSQZ archive data =FGF95aFGF image (GIF+deflate beta)image/x-unknown =FCS3.0Flow Cytometry Standard (FCS) data, version 3.0 =FCS2.0Flow Cytometry Standard (FCS) data, version 2.0 =FCS1.0Flow Cytometry Standard (FCS) data, version 1.0 =DfuSeDFU image (STM variant)dfux , size: %d bytes= UFDmagic/firmwarex , for device %04X:x %04X = CtrsTICitrus locale declaration for LC_TIME = CtrsNUCitrus locale declaration for LC_NUMERIC = CtrsMOCitrus locale declaration for LC_MONETARY =CtrsMECitrus locale declaration for LC_MESSAGES =CROMFSCROMFS> version %2.2s,> block data at %lld,> fblock table at %lld,> inode table at %lld,>  root at %lld,> ( fblock size = %d,> , block size = %d,>0 bytes = %lld =CBMdPower 64 C64 Emulator Snapshot =B&W256ImageLab bitmapimage/x-ilabb_w/b&wx, %uxx %u =AC2.22DWG AutoDesk AutoCAD Release 2.22image/vnd.dwg =AC2.21DWG AutoDesk AutoCAD Release 2.21image/vnd.dwg =AC2.10DWG AutoDesk AutoCAD Release 2.10image/vnd.dwg =AC1035DWG AutoDesk AutoCAD 2021image/vnd.dwg =AC1032DWG AutoDesk AutoCAD 2018/2019/2020image/vnd.dwg =AC1027DWG AutoDesk AutoCAD 2013-2017image/vnd.dwg =AC1024DWG AutoDesk AutoCAD 2010/2011/2012image/vnd.dwg =AC1021DWG AutoDesk AutoCAD 2007/2008/2009image/vnd.dwg =AC1018DWG AutoDesk AutoCAD 2004/2005/2006image/vnd.dwg =AC1015DWG AutoDesk AutoCAD 2000image/vnd.dwg =AC1014DWG AutoDesk AutoCAD Release 14image/vnd.dwg =AC1013DWG AutoDesk AutoCAD Release 13c3image/vnd.dwg =AC1012DWG AutoDesk AutoCAD Release 13image/vnd.dwg =AC1009DWG AutoDesk AutoCAD Release 11/12image/vnd.dwg =AC1006DWG AutoDesk AutoCAD Release 10image/vnd.dwg =AC1004DWG AutoDesk AutoCAD Release 9image/vnd.dwg =AC1003DWG AutoDesk AutoCAD Release 2.60image/vnd.dwg =AC1002DWG AutoDesk AutoCAD Release 2.50image/vnd.dwg =AC1001DWG AutoDesk AutoCAD Release 2.22image/vnd.dwg =AC1.50DWG AutoDesk AutoCAD Release 2.05image/vnd.dwg =AC1.40DWG AutoDesk AutoCAD Release 1.40image/vnd.dwg =ABF2Biosig/Axon Binary formatbiosig/abf2 =`@ MFR Biosig/MFERbiosig/mfer =7z'7-zip archive data,xversion %dx.%dapplication/x-7z-compressed7z/cb7 =k070707ASCII cpio archive (pre-SVR4 or odc)application/x-cpiocpio/cpi/008/012 =u070702ASCII cpio archive (SVR4 with CRC)application/x-cpio/cpio =p070701ASCII cpio archive (SVR4 with no CRC)application/x-cpiocpio =.MCAD Mathcad document =*BEGINApplixware=WORDSWords Document= GRAPHICSGraphic= RASTERBitmap=  SPREADSHEETSSpreadsheet= MACROMacro= BUILDERBuilder Object =%TGIF Tgif file versionx%s = $SuiteTTCN Abstract Test Suite= $SuiteIdmagic/communications> %s= $SuiteIdmagic/communications> %s=$SuiteIdmagic/communications> %s =#usda USD ASCIIx, version %stext/plainusd =M# daubMaple help file, old style =# .PCDPoint Cloud Data =@EJLEpson ESC/Page language printer data = Claris Works palette files .plt =TPACTPac archive data =nrvNRV archive data =MVR5 Maple Vr5 libraryapplication/x-maple-liblib =Q$Maple worksheet@=+`'(version %.3s)application/xhtml+xml= +e,(version %.3s)application/xhtml+xml (=>+m@P[0-9][0-9]\.[0-9][0-9][0-9][0-9]\.[0-9][0-9][0-9][0-9]\.[0-9]NAXOS CAD System file from version %s( =+ }magic/images= magic/images!magic/images!Macintosh QuickDraw PICT, version 2image/x-pict????PICTpict/pic/pct= * @QuickTime, QuickTime= P decompressorwith decompressor=NoneNone=CinepakCinepak=  Photo - JPEGJPEG=  Compact Videocvidxmagic/imagesx"%0.6s"x, %u!-%dxx %u!-%d!, at 0x%.4sx, at 528 %#4.4xx(, at 552 second opcode %#4.4x!, at the end %#4.4x opcode@= Microsoft OOXML x?Microsoft OOXML x@Microsoft OOXMLxAMicrosoft OOXMLxBMicrosoft OOXMLxCMicrosoft OOXML= D\[trash\]magic/msooxml=EpPKmagic/msooxml=FpPKmagic/msooxml=.Gmsooxmlmagic/msooxmlxHmagic/msooxml=IpPKmagic/msooxml=.Jmsooxmlmagic/msooxmlxKMicrosoft OOXMLxLMicrosoft OOXMLxMMicrosoft OOXML =xsHP-UXmagic/hp=tmagic/hp= umagic/hp=vmagic/hp=wmagic/hp= xDmagic/hp=hymagic/hp=tz<magic/hp={core file >X|from '%s' =}- received SIGQUIT =~- received SIGILL =- received SIGTRAP =- received SIGABRT =- received SIGEMT =- received SIGFPE = - received SIGBUS = - received SIGSEGV = - received SIGSYS =!- received SIGXCPU ="- received SIGXFSZ=magic/hp= Dmagic/hp=Tmagic/hp=`magic/hp=dmagic/hp=hmagic/hp=t,magic/hp=core file >Dfrom '%s' =- received SIGQUIT =- received SIGILL =- received SIGTRAP =- received SIGABRT =- received SIGEMT =- received SIGFPE = - received SIGBUS = - received SIGSEGV = - received SIGSYS =!- received SIGXCPU ="- received SIGXFSZ =d]HP-UXmagic/hp=^magic/hp= _Dmagic/hp=T`magic/hp=`a<magic/hp=bmagic/hp=cmagic/hp=dmagic/hp=ecore file >Dffrom '%s' =g- received SIGQUIT =h- received SIGILL =i- received SIGTRAP =j- received SIGABRT =k- received SIGEMT =l- received SIGFPE =m - received SIGBUS =n - received SIGSEGV =o - received SIGSYS =p!- received SIGXCPU =q"- received SIGXFSZ =<RINEXmagic/meteorological=P XXRINEXBRINEX Data, GEO SBAS Broadcastx , date %15.15sx , version %6.6srinex/broadcast=P XXRINEXDRINEX Data, Observation (Hatanaka comp)x , date %15.15sx, version %6.6srinex/observation=PXXRINEXCRINEX Data, Clockx , date %15.15sx, version %6.6srinex/clock=PXXRINEXHRINEX Data, GEO SBAS Navigationx , date %15.15sx, version %6.6srinex/navigation=PXXRINEXGRINEX Data, GLONASS Navigationx , date %15.15sx, version %6.6srinex/navigation=PXXRINEXLRINEX Data, Galileo Navigationx , date %15.15sx, version %6.6srinex/navigation=P!XXRINEXMRINEX Data, Meteorologicalx ", date %15.15sx#, version %6.6srinex/meteorological=P%XXRINEXNRINEX Data, Navigationx &, date %15.15sx', version %6.6srinex/navigation=P)XXRINEXORINEX Data, Observationx *, date %15.15sx+, version %6.6srinex/observation =8sunosmagic/netbsd=.ktracemagic/netbsd =8linuxmagic/netbsd=.ktracemagic/netbsd =$GHP-UXmagic/hp=Hmagic/hp= Imagic/hp=Jmagic/hp=Kmagic/hp= L<magic/hp=`Mmagic/hp=lNDmagic/hp=Ocore file >Pfrom '%s' =Q- received SIGQUIT =R- received SIGILL =S- received SIGTRAP =T- received SIGABRT =U- received SIGEMT =V- received SIGFPE =W - received SIGBUS =X - received SIGSEGV =Y - received SIGSYS =Z!- received SIGXCPU =["- received SIGXFSZ =XIMGmagic/images=.gem_infomagic/images =TIMGmagic/images=.gem_infomagic/images =HP-UXmagic/hp=magic/hp= <magic/hp=L!magic/hp=X"Dmagic/hp=#magic/hp=$magic/hp=%magic/hp=&core file >'from '%s' =(- received SIGQUIT =)- received SIGILL =*- received SIGTRAP =+- received SIGABRT =,- received SIGEMT =-- received SIGFPE =. - received SIGBUS =/ - received SIGSEGV =0 - received SIGSYS =1!- received SIGXCPU =2"- received SIGXFSZ=L4magic/hp=X5magic/hp=\6magic/hp=`7magic/hp=l8Dmagic/hp=9core file >:from '%s' =;- received SIGQUIT =<- received SIGILL ==- received SIGTRAP =>- received SIGABRT =?- received SIGEMT =@- received SIGFPE =A - received SIGBUS =B - received SIGSEGV =C - received SIGSYS =D!- received SIGXCPU =E"- received SIGXFSZ = t magic/images=v magic/images=.w ulead-imaginfomagic/images={ magic/images=.| ulead-imaginfomagic/images = EXFATmagic/filesystems=  Umagic/filesystems=n magic/filesystems=o magic/filesystems= DOS/MBR boot sector,xiExFAT Filesystem version %d.xh%dxm, (1<<%d) sectors per clusterxH, sectors %lldx d, serial number %#x =magic/claris= Claris clip art =magic/claris= Claris clip art =-pm2-magic/archive= .lharc-filemagic/archive =-pm1-magic/archive= .lharc-filemagic/archive =-pm0-magic/archive= .lharc-filemagic/archive =-lzs-magic/archive= .lharc-filemagic/archive =-lz8-magic/archive= .lharc-filemagic/archive =-lz7-magic/archive= .lharc-filemagic/archive =-lz5-magic/archive= .lharc-filemagic/archive =-lz4-magic/archive= .lharc-filemagic/archive =-lz3-magic/archive= .lharc-filemagic/archive =-lz2-magic/archive= .lharc-filemagic/archive =-lhx-magic/archive= .lharc-filemagic/archive =-lhe-magic/archive= .lharc-filemagic/archive =-lhd-magic/archive= .lharc-filemagic/archive =-lhc-magic/archive= .lharc-filemagic/archive =-lhb-magic/archive= .lharc-filemagic/archive =-lha-magic/archive= .lharc-filemagic/archive =-lh9-magic/archive= .lharc-filemagic/archive =-lh8-magic/archive= .lharc-filemagic/archive =-lh7-magic/archive= .lharc-filemagic/archive =-lh6-magic/archive= .lharc-filemagic/archive =-lh5-magic/archive= .lharc-filemagic/archive =-lh4-magic/archive= .lharc-filemagic/archive =-lh3-magic/archive= .lharc-filemagic/archive =-lh2-magic/archive= .lharc-filemagic/archive =-lh1-magic/archive= .lharc-filemagic/archive =-lh0-magic/archive= .lharc-filemagic/archive =BEA01magic/filesystems= .extendedareamagic/filesystems =Eustarmagic/gentoo=Fd/gpkg-1magic/gentoo=G[^/]+Gentoo GLEP 78 (GPKG) binary package for "%s"application/vnd.gentoo.gpkgtar= |K00000000000magic/gentoo=Md.tar.magic/gentoo=Ngzusing gzip compression=Obz2using bzip2 compression=Plzusing lzip compression=Qlz4using lz4 compression=Rlzousing lzo compression=Sxzusing xz compression=Tzstusing zstd compression=;|Uc.sig, signed =begmfmagic/images!magic/images!clear text Computer Graphics Metafileimage/cgmcgmx%s= mfversionmagic/images>1, version %c = {\rtfmagic/rtf! magic/rtf!\Rich Text Format datatext/rtf????RTFrtf=.rtf-infomagic/rtf = tree magic/git=  [0-9a-f]+Git tree %s =blob magic/git= [0-9a-f]+Git blob %s =TVS magic/animation=Version TeamViewer Session Filex, version %s = TABLEmagic/dif=0,magic/dif=TUPLESData Interchange Formatapplication/x-difdif= "magic/dif!", generator or table namex %s =LANG magic/ispell= .spell-affmagic/ispell = DIST magic/gentoo=.gentoo-manifestmagic/gentoo = DATA magic/gentoo=. gentoo-manifestmagic/gentoo =Abortmagic/msdos= Non-DOS diskNorton Commander module messageapplication/x-norton-msgmsg =8w Version %s>*x : %s =JarJAR (ARJ Software, Inc.) archive dataapplication/x-compress-jx , CRC32 %#xj/j01/j02 = 8@MAJYOXLD4(Q4) picture = CDROMHigh Sierra CD-ROM filesystem dataiso>0 '%.32s' = pMGD77MGD77 Header, Marine Geophysical Data Exchange Format =kGSF-vSAIC generic sensor format (GSF) sonar data,=l[0-9]+\.[0-9]+version %s =gECXMECX module =-pc1-PopCom compressed executable (CP/M) =-sw1-Swag archive data =-pms-PMarc SFX archive (CP/M, DOS)com =m-afx-AFX compressed file data =-LH1-LHA archive (c64) =CD001ISO 9660 CD-ROM filesystem data (raw 2352 byte sectors)application/x-iso9660-image =0CD001Nero CD image at 0x4B000application/x-nrgnrg=.cdrommagic/filesystems =@mgs2 MSX Gigamix MGSDRV2 music file= magic/msx= .magic/msx>0, title: %s =  SEGASega Mega Drive / Genesis ROM image=.!sega-mega-drive-headermagic/console =@PO^Q`Microsoft Word 6.0 Documentapplication/msword =@BZ3v1bzip3 compressed datax , blocksize %u = @=órlSereal data packet, UTF-8 encodedapplication/sereal=."serealmagic/sereal = Wavelet Scalar Quantization image data =U{\pwdPocket Word document or templateapplication/x-pocket-wordpwd/psw/pwt=.]rtf-infomagic/rtf =dsnoopSnoop capture file>e- version %d= f(IEEE 802.3)= g(IEEE 802.4)= h(IEEE 802.5)= i(IEEE 802.6)= j(Ethernet)= k(HDLC)= l(Character synchronous)= m(IBM channel-to-channel adapter)= n(FDDI)= o (Other)= p (type %d)= q (type %d)= r (type %d)= s (type %d)= t(type %d)= u(type %d)= v(Fibre Channel)= w(ATM)= x(ATM Classical IP)= y(type %d)= z(type %d)= {(type %d)= |(type %d)= }(type %d)= ~(type %d)= (type %d)= (IP over Infiniband)> (type %d) ="sim65sim65 executable,x#version %d,= $6502= %65C02 =|rootROOT filex}Version %dx!~(Compression: %d) = llvc2LLVM byte-codes, bzip2 compression = llvc1LLVM byte-codes, gzip compression = llvc0LLVM byte-codes, null compression =g GCEVectrex ROM image>: "%.16s" =\1cw ChiWriter file>version %s =ZendPHP script Zend Optimizer data =xZZ ZZip archive data =XIA1 Chiasmus Encrypted dataxia =%X 495SoftQuad troff Context intermediate for AT&T 495 laser printer =WARC/WARC Archivexversion %.4sapplication/warc =ULEB RAX archive data =ULEBXtreme archive data =TiEmuTiEmu skin=v- Version> %cx .%cx %c =zTRdHP/UX nettl capture fileapplication/x-nettltrc0/trc1! /tmp/wireshark.TRC000magic/snifferx "%-.56s"!DUTC, tzxD%-.20s>X, host %-.9s!aB.11.11, osxa%-.9sxj(%#x)!k, xxa=%#16.16llx!s9000/800, modelxs%-.11s!~, at 126 %#4.4x =wSQWEZSQWEZ archive data =SHCC3MS Windows 3.1 registry file =JSAP Atari 8-bit SAP audio fileaudio/x-sapsap=MNAMEmagic/audioxN: %s=OAUTHORmagic/audioxPby %s =^REDISRedis RDB file,=_[0-9][0-9][0-9][0-9]version %s =OPVF2 portable voice format>P(ascii %s) =IPVF1 portable voice format>J(binary %s) =cPSDBPanasonic channel list DataBasedb/bin=~fSQLite format 3magic/sqlx)h; contains =>PPF30Playstation Patch File version 3.0=?, PPF 1.0 patch=@, PPF 2.0 patch=A, PPF 3.0 patch=8B, Imagetype BIN (any)=8C, Imagetype GI (PrimoDVD)=9D, Blockcheck disabled=9E, Blockcheck enabled=:F, Undo data not available=:G, Undo data availablexH, description: %s =JPPF20Playstation Patch File version 2.0=K, PPF 1.0 patch=L, PPF 2.0 patch> 8M, size of file to patch %dxN, description: %s =PPPF10Playstation Patch File version 1.0=Q, Simple EncodingxR, description: %s =PGDMPPostgreSQL custom database dumpx- v%dx.%d<-0>magic/databasex-%d = PFS1 PFS HDR image data= [0-9]* , %s=  [0-9]{4}x%s =#PATCHIPS patch fileips =ENESMNES Sound File>F("%s" by>.G%s, copyright>NH%s),xIversion %d,xJ%d tracks,=zKdual PAL/NTSC=zLPAL=zMNTSC =MSTSMNPack archive data =MC0.0DWG AutoDesk AutoCAD Release 1.0image/vnd.dwg =MAS_UULT(imate) Module sound data =MAPZ)Map file for the Blood Frontier/Red Eclipse FPS games = JOYLocoScript 4 document = JOYLocoScript 3 document =JOYLocoScript 2 document =JOYLocoScript 1 document =JARCSJAR (ARJ Software, Inc.) archive dataapplication/x-compress-jarjar =i IIO2HUlead Photo Explorer 4 or 5image/x-ulead-pe4pe4/pe5=o JFIFwith JPEG image data=.p jpegmagic/images =T IIO1$Ulead Photo Explorer 3image/x-ulead-pe3pe3=Z :\magic/imagesx\ "%s"x^ magic/images=_ \\magic/imagesxa "%s" =HVQM4%s>v%sxGameCube movie,x4%d xx6%d,x&%dus,=Bno audio>B%dHz audio =HREFST-Guide reference file =uHLSQZSqueeze It archive data =HDOCST-Guide file =:From Mailbox textapplication/mbox/mboxx@, 1st line "%s" =FONTRISC OS 4bpp font dataxversion %d =FONTRISC OS 1bpp font data,xversion %d =FONTRISC OS outline font data,xversion %d =fEMODAmiga E module = DOCLocoScript Professional document = DOCLocoScript PC document =D1.0 X11 Speedo font data =6CoreAlpha COFF format core dump (Digital UNIX)>7, from '%s' =4CoreAlpha COFF format core dump (Digital UNIX)>5, from '%s' =ChfLZChiefLZA archive data =sCRUSHCrush archive data =$COSOHippel-COSO Module sound file =BlinkBlink archive data =#BeEpJamCracker Module sound file =fBCFBinary Call Format (BCF) version 2.2> hmagic/bioinformatics=j##samtoolsVersion=magic/bioinformaticsxk, generated by SAMtools version %s =YBCFBinary Call Format (BCF) version 2.1> [magic/bioinformatics=]##samtoolsVersion=magic/bioinformaticsx^, generated by SAMtools version %s =AiAi archive dataapplication/x-compress-aiai =AiAi archive dataapplication/x-compress-aiai =-APS10APS patch fileaps=/, simple patch=0, N64-specific patch forx:1N%cx;2%cx<3%c!4 magic/consolex6: "%.50s" =AKT32AKT32 archive data =AC1.3DWG AutoDesk AutoCAD Release 1.3image/vnd.dwg =AC1.2DWG AutoDesk AutoCAD Release 1.2image/vnd.dwg =@âPack Magic archive data = %.3s =0gawaABC 3d model =u*mbx*MBX mail folder =%%HP:HP text=T(0)- T(0)=T(1)- T(1)=T(2)- T(2)=T(3)- T(3)= A(D)A(D)= A(R)A(R)= A(G)A(G)=F(.)F(.);=F(,)F(,); =%!VMFSunClock's Vector Map Format data = $HDTHDT file (binary compressed indexed RDF triples) type 1application/vnd.hdthdt =2#!BPYBlender3D BPython script =#!AMRAdaptive Multi-Rate Codec=-WB(Wideband)audio/AMR-WB????amrwawbx(GSM telephony)audio/AMR????amramr =J Freeze archive data =%-1BHewlett-Packard Graphics Language 2application/vnd.hp-HPGLpltxwith "%-.10s" ="AFS Dumpx(v%d)=vmagic/filesystemsxVol %d,=nmagic/filesystemsx%s=tmagic/filesystems=magic/filesystemsx on: %s= full dump! incremental since: %s =?ZPKZPack archive data =H8LApple ProDOS Image=Jmagic/apple&Kmagic/applexL, Volume /%sx )M, %u Blocks= Omagic/apple& Pmagic/applex Q, Volume /%sx ) R, %u Blocks =o65o65= executable,= object,xversion %d,= 65816,= 6502,=  32 bit,=  16 bit,= @@page reloc,= @byte reloc,= alignment 1= alignment 2= alignment 4= alignment 256 =jBONKBONK,xl%d channel(s),=mlossless,=nlossy,xomid-side =Netscape folder cache =(3b2 core file>l)of '%s' =MSVC .sbr>%s@(=+$ packagemagic/perl=W%^package[[:space:]]+[0-9A-Za-z_:]+[[:space:]]*([[:space:]]v?[0-9][0-9.]*)?[[:space:]]*;Perl5 module source text@K!+( pmagic/perl=W)^package[[:space:]]+[0-9A-Za-z_:]+[[:space:]]*([[:space:]]v?[0-9][0-9.]*)?[[:space:]]*;magic/perl=0*^1[[:space:]]*;|^(use|sub|my)[[:space:]].*[(;{=]Perl5 module source text@=+"^(const|var|let).*=.*require\(JavaScript sourceapplication/javascriptjs`= +IePKmagic/archive= ?APK Sig Block 42, with APK Signing Blockx@magic/archive= Bres/drawableAndroid package (APK), with MANIFEST.MF and drawablesapplication/vnd.android.package-archiveapk=EPKmagic/archive= FAPK Sig Block 42, with APK Signing BlockxHJava archive data (JAR)application/java-archivejar=Mmagic/archive=N!!magic/archive= Omagic/archive=PAndroid package (APK), with zipflinger virtual entryapplication/vnd.android.package-archiveapk=SPKmagic/archive= TAPK Sig Block 42, with APK Signing Block= YPKmagic/archive= \(#kmp.jsonKeyman Compiled Package Fileapplication/vnd.keyman.kmp+zipkmp=dmimetypeapplication/magic/archive=2kvnd.kde.KOffice (>=1.2)=:lkarbonKarbon document=:mkchartKChart document=:nkformulaKFormula document=:okivioKivio document=:pkontourKontour document= :qkpresenterKPresenter document=:rkspreadKSpread document=:skwordKWord document= 2yvnd.sun.xml.OpenOffice.org 1.x=>zwriterWriter!D{.documentapplication/vnd.sun.xml.writersxw= D~.templatetemplateapplication/vnd.sun.xml.writer.templatestw=D.webWeb templateapplication/vnd.sun.xml.writer.webstw=D.globalglobal documentapplication/vnd.sun.xml.writer.globalsxg=>calcCalc!B.spreadsheetapplication/vnd.sun.xml.calcsxc= B.templatetemplateapplication/vnd.sun.xml.calc.templatestc=>drawDraw!B.documentapplication/vnd.sun.xml.drawsxd= B.templatetemplateapplication/vnd.sun.xml.draw.templatestd=>impressImpress!E.presentationapplication/vnd.sun.xml.impresssxi= E.templatetemplateapplication/vnd.sun.xml.impress.templatesti=>mathMath documentapplication/vnd.sun.xml.mathsxm=>baseDatabase fileapplication/vnd.sun.xml.basesdb=2vnd.openofficeorg.OpenOffice= Dextension/LibreOffice Extensionapplication/vnd.openofficeorg.extensionoxt=2vnd.oasis.opendocument.OpenDocument=Itextmagic/archive!M-Textapplication/vnd.oasis.opendocument.textodt= M-templateText Templateapplication/vnd.oasis.opendocument.text-templateott=M-webHTML Document Templateapplication/vnd.oasis.opendocument.text-weboth=M-mastermagic/archive!T-Master Documentapplication/vnd.oasis.opendocument.text-masterodm= T-templateMaster Templateapplication/vnd.oasis.opendocument.text-master-templateotm=Igraphicsmagic/archive!Q-Drawingapplication/vnd.oasis.opendocument.graphicsodg= Q-templateDrawing Templateapplication/vnd.oasis.opendocument.graphics-templateotg= Ipresentationmagic/archive!U-Presentationapplication/vnd.oasis.opendocument.presentationodp= U-templatePresentation Templateapplication/vnd.oasis.opendocument.presentation-templateotp= Ispreadsheetmagic/archive!T-Spreadsheetapplication/vnd.oasis.opendocument.spreadsheetods= T-templateSpreadsheet Templateapplication/vnd.oasis.opendocument.spreadsheet-templateots=Ichartmagic/archive!N-Chartapplication/vnd.oasis.opendocument.chartodc= N-templateChart Templateapplication/vnd.oasis.opendocument.chart-templateotc=Iformulamagic/archive!P-Formulaapplication/vnd.oasis.opendocument.formulaodf= P-templateFormula Templateapplication/vnd.oasis.opendocument.formula-templateotf=IdatabaseDatabaseapplication/vnd.oasis.opendocument.databaseodb=IbaseDatabaseapplication/vnd.oasis.opendocument.baseodb=Iimagemagic/archive!N-Imageapplication/vnd.oasis.opendocument.imageodi= N-templateImage Templateapplication/vnd.oasis.opendocument.image-templateoti=2epub+zipEPUB documentapplication/epub+zip=2hwp+zipHancom HWP (Hangul Word Processor) file, HWPXapplication/x-hwp+ziphwpx= 2 x-vnd.corel.Corel=> draw.document+zipDraw drawing, version 14-16application/x-vnd.corel.draw.document+zipcdr=>draw.template+zipDraw template, version 14-16application/x-vnd.corel.draw.template+zipcdrt=>zcf.draw.document+zipDraw drawing, version 17-22application/x-vnd.corel.zcf.draw.document+zipcdr=>zcf.draw.template+zipDraw template, version 17-22application/x-vnd.corel.zcf.draw.template+zipcdt/cdrt=>zcf.pattern+zipDraw pattern, version 22application/x-vnd.corel.zcf.pattern+zippat=> designer.document+zipDESIGNER graphics, version 14-16application/x-vnd.corel.designer.document+zipdes=>#zcf.designer.document+zipDESIGNER graphics, version 17-21application/x-vnd.corel.zcf.designer.document+zipdes=>(symbol.library+zipSymbol Library, version 6-16.3application/x-vnd.corel.symbol.library+zipcsl=>+zcf.symbol.library+zipSymbol Library, version 17-22application/x-vnd.corel.zcf.symbol.library+zipcslx25Zip data= &6[!-OQ-~]+(MIME type "%s"?)application/zip= 9mimetypemagic/archive! &:application/magic/archive= &;[!-OQ-~]+Zip data (MIME type "%s"?)application/zip= ?Java archive data (JAR)application/java-archivejar! Dmagic/archive! Emimetypemagic/archive=FPayload/magic/archive=&G@.app/iOS Appapplication/x-ios-app! Pmagic/archive!Qd@application/epub+zipmagic/archive! RmimetypeZip archive dataapplication/zipxT, at least= .Uzipversionmagic/archivexVto extractxW, compression method==.Xzipcompressionmagic/archive=aYWINZIP, WinZIP self-extractingx[magic/archive=\PKmagic/archive= ]APK Sig Block 42Android package (APK), with APK Signing Blockapplication/vnd.android.package-archiveapk=rPKmagic/zip=. zzipcdmagic/zip> ~0, %s=t STOPmagic/archive=u XPAKSTOPGentoo binary package (XPAK)application/vnd.gentoo.xpak= 8magic/rpi= magic/rpi= magic/rpi= magic/rpi=283xmagic/rpi= magic/rpi= magic/rpi=DTOKmagic/rpi= magic/rpi= $magic/rpi =(DDTK8magic/rpi = 0magic/rpi =4RPTLRaspberry PI kernel image= ,magic/rpi= magic/rpi= magic/rpi= magic/rpi= 283xmagic/rpi=  magic/rpi=  magic/rpi= DTOKmagic/rpi= ,magic/rpi= $magic/rpi =(RPTLRaspberry PI kernel image@=+A usingmagic/c-lang=@B^using[[:space:]]+(namespace )?std(::)?[[:alpha:]]*[[:space:]]*;C++ source texttext/x-c++@=+==magic/rst=^[=]+$magic/rst=:Author:ReStructuredText file=   Authors:ReStructuredText file=  Author:ReStructuredText filex magic/rst=  ^\.\.[A-Za-z]ReStructuredText filerst@=+.^(import|export).* from JavaScript sourceapplication/javascriptjs((=-magic/images!(magic/images>*magic/images<,"magic/images!. magic/images=0magic/images!3magic/images= .4tga-imagemagic/images=5magic/images= .6tga-imagemagic/images=7magic/images= .8tga-imagemagic/images=9magic/images= .:tga-imagemagic/images=;magic/images= .<tga-imagemagic/images== magic/images= .>tga-imagemagic/images(= magic/filesystems=  magic/filesystems= magic/filesystems= magic/filesystems= magic/filesystems< F@magic/filesystems>  !magic/filesystems=  [[:print:]]*NEC PC-88 disk image, name=%s= , media=2D= , media=2DD= , media=2HD= 0, media=1D= @, media=1DD= , write-protected(= magic/images= magic/images= Aseprite asset fileasepritex , size %ux , frames %ux , size %uxx %u=  , RGBA= , Grayscale= , Indexedx , flags %#xx, transparency index %ux , number of colors %u>", pixel ratio %u:x#%ux $, grid position (%d, x &%d)x (, grid size %dxx *%d(=  magic/filesystems= littlefslittlefs superblockx  , version %ux  .%ux  , block size: %u bytesx  , %u blocks(= Smagic/wordprocessors= V^(main|opt)gfxboot compiled html help file, label %sapplication/x-gfxboot-hlphlp=[, title= ]^[[:print:]]+'%s'(= 0FPRmagic/games<  RAGE Package Format (RPF), version %d, used in= Rockstar Table Tennis,= !*unknown*= "GTA IV,= #GTA IV Audio & Midnight Club: LA,= $Max Payne 3,= %*unknown*= &RDR,= 'GTA V,= (RDR 2,x )%d bytes,x *%d entries(= 뛐magic/filesystems= /Boot failedmagic/filesystems= LDLINUX SYSSyslinux bootloader (version 2.13 or older)=XSyslinux bootloader (version 3.0-3.9)= Boot error magic/filesystems=XSyslinux bootloader (version 3.10 or newer)(= magic/archive=  Synology archivespk=+ package=magic/archivex , package %s=+ arch=magic/archivex %s=+ version=magic/archivex %s= + create_time=magic/archivex , created on %s(= magic/firmware= Silicon Labs Gecko bootloader update imagegbl= , encrypted (AES-CTR-128)= , signed (ECDSA-P256)=  , application image=  , bootloader image(= fv4magic/android=hmagic/android< jPartition Information Table for Samsung smartphonex k, %d entries> m; #1= .nPIT-entrymagic/android> o; #2= .pPIT-entrymagic/android> q; #3= .$rPIT-entrymagic/android> s; #4= .tPIT-entrymagic/android> u; #5= .,vPIT-entrymagic/android> w; #6= .xPIT-entrymagic/android> y; #7= .4zPIT-entrymagic/android> {; #8= .|PIT-entrymagic/android> }; #9= .<~PIT-entrymagic/android>  ; #10= .PIT-entrymagic/android>  ; #11= .DPIT-entrymagic/android>  ; #12= .PIT-entrymagic/android>  ; #13= .LPIT-entrymagic/android>  ; #14= .PIT-entrymagic/android> ; #15= .TPIT-entrymagic/android> ; #16= .PIT-entrymagic/android> ; #17= .\PIT-entrymagic/android> ; #18= .PIT-entrymagic/android(=  magic/firmware= 8Silicon Labs Gecko EmberZNet OTA imageota/zigbeexv%d(= (-magic/sql=.)shm-lemagic/sql(= ; magic/images= D Sony PlayStation PSX image,image/x-sony-timtim= J 4-Bit,= K 8-Bit,= M 15-Bit,= N 24-Bit,= P Mixed-Bit,& R magic/images x  U Pixel at (%d,x V %d) Size== X magic/imagesx Y %d= Z magic/imagesx [ %dx ] x%d,= ^ 16 CLUT Entries at= _ 256 CLUT Entries atx ` (%d,x a %d)^ c magic/imagesx e Pixel at (%d,x f %d) Size== h magic/imagesx i %d= j magic/imagesx k %d= l magic/imagesx m %d= n magic/imagesx q 2/3*%d= s magic/imagesx t %dx v x%d(= = magic/sniffer= >M<+pcapng capture filex ?- version %dx @.%d(= magic/archive=  {"files":{"magic/archive=  }}}}Electron ASAR archiveasarx , header length: %d bytes(= magic/msdos=( EMFWindows Enhanced Metafile (EMF) image datax , version %#x(= 2Kmagic/firmware= ! X`magic/firmware= h!magic/firmware= (magic/firmware= magic/firmware= magic/firmware= magic/firmware= magic/firmware= ,magic/firmware = 8Raspberry Pi RP2040 firmware > , initial SP at 0x%08x x , reset at 0x%08x x , NMI at 0x%08x x  , HardFault at 0x%08x x ,, SVCall at 0x%08x x 8, PendSV at 0x%08x =q, with binary_info(= 7magic/database= .8xbase-indexmagic/database(= :magic/database= .;xbase-indexmagic/database(= =magic/database!?versionmagic/database=Amagic/database= .Dxbase-indexmagic/database(= magic/games= $GTA2 binary main script (SCR)(= magic/games< magic/games> magic/games< ȯGTA audio index data (SDT)(=magic/wordprocessors= .^PageMakermagic/wordprocessors(=magic/wordprocessors= .PageMakermagic/wordprocessors(=magic/database=Extensible storage engineapplication/x-ms-ese= DataBaseedb/sdb= STreaMingstmx , version %#x> revision %#4.4xx, checksum %#8.8xx, page size %lld= 4, JustCreated= 4, DirtyShutdown= 4, BeingConverted= 4, ForceDetachx , Windows version %dx .%d(=& magic/msvc = *magic/msvc=.+omf-libmagic/msvc(=Rmagic/images!TSGI image dataimage/x-sgi????.SGI=Z, RLE=^, high precisionxa, %d-Dxc, %d xxe%dx g, %d= jchannelbw= schannelsrgb/sgi= uchannelsrgba/sgix wchannelssgi>{, "%0.80s"! }, %u PINMIN!, %u PINMAX!, at 20 %#x!h, %u COLORMAP!o, at 111 %#x!q, at 113 %#x!v, at 118 %#4.4x!y, at 121 %#x!, at 132 %#8.8x!, at 135 %#x!, at 137 %#16.16llx(=I magic/virtual>Jmagic/virtual=Kmagic/virtual< L(QEMU replayxM, version %d=N(QEMU 2.10-2.11)=O(QEMU 2.12-4.1)=P(QEMU 4.2)=Q (QEMU 5.0)=R (QEMU 5.1-7.0)=S (QEMU 7.1+)(= magic/images>magic/images<magic/images!magic/images!PCXimage/vnd.zbrush.pcxpcx/pcc=ver. 2.5 image data=ver. 2.8 image data, with palette=ver. 2.8 image data, without palette=for Windows image data=ver. 3.0 image datax bounding box [%d,x %d] -x [%d,x %d],>A%d planes each ofx%d-bit=Dcolour,=Dgrayscale,xDimage,> %d xx %d dpi,=uncompressed=RLE compressed(= PFLmagic/images=  Lytro Light Field Picturex , version %u(= @magic/windows=Windows Performance Monitor Alertapplication/x-perfmonpmaxP, "%s"(=d(magic/images=fmagic/imagesx$hX-Window screen dump image data, version X10image/x-xwindowdumpxwdxn, %dxpx%dx rx%u! |, x=%d!"~, y=%d!$, %u border(=+-magic/sql=.,^shm-lemagic/sql(=9 magic/sniffer=:M<+pcapng capture filex ;- version %dx<.%d(= magic/images=  PresetInfoUlead pattern imageimage/x-ulead-pstpstx  "%s" = +MMmagic/cad= magic/cad=   magic/cad= !==3D Studio modelimage/x-3ds3ds =+magic/animation!magic/animation!MPEG ADTS, layer III, v1audio/mpeg=!, 32 kbps=" , 40 kbps=#0, 48 kbps=$@, 56 kbps=%P, 64 kbps=&`, 80 kbps='p, 96 kbps=(, 112 kbps=), 128 kbps=*, 160 kbps=+, 192 kbps=,, 224 kbps=-, 256 kbps=., 320 kbps=0 , 44.1 kHz=1 , 48 kHz=2 , 32 kHz=4, Stereo=5@, JntStereo=6, 2x Monaural=7, Monaural =+bPKZip archive data (empty)application/zipzip/cbz = +'Mach-Oapplication/x-mach-binary= .*^mach-o-bemagic/mach = +Android binary XML =+,Mach-Oapplication/x-mach-binary= ./mach-o-bemagic/mach =Version=magic/windows= EventTypeWindows Error Reporttext/plainwer =J@SCMDmagic/msx= KMSX SCMD Music file>M, title: %s =FEAMGmagic/console=GSega Mega Drive / Genesis ROM image (SMD format):application/x-genesis-rom=.Isega-genesis-smd-headermagic/console =@EAGNmagic/console=ASega Mega Drive / Genesis ROM image (SMD format):application/x-genesis-rom=.Csega-genesis-smd-headermagic/console =<librmagic/palm= magic/palm>Palm OS dynamic library data "%s" =8hpuxmagic/netbsd=.ktracemagic/netbsd =$acspmagic/icc= .color-profilemagic/icc =sdbfmagic/database=magic/database= xWindows application compatibility Shim DataBaseapplication/x-ms-sdbsdb =itchmagic/apple=artwmagic/apple=dataiTunes cover art=PNG(PNG)=(JPEG) = WSVDmagic/archive= @Wasay ImageIt DataPackx  v%ux .%ux , "%s"x (%u)x , created on %02dx! %02dx" /%02dx# /%02dx$ %02dx% :%02dx& :%02dx 8 , size: %u bytes =BOBOmagic/apple>magic/apple= magic/apple=magic/apple= .appleworksmagic/apple=magic/apple= .appleworksmagic/apple = JFS1magic/filesystems<  JFS2 filesystem image=  [ -~]{1,16}(label "%s")x , %lld blocksx ! , blocksize %d> " (dirty)> $# (compressed) =SEGAmagic/console=MARS CHECK MODESega 32X ROM imageapplication/x-genesis-32x-rom=.sega-mega-drive-headermagic/console= PICOSega Pico ROM imageapplication/x-sega-pico-rom=.sega-mega-drive-headermagic/console=  TOYS PICOSega Pico ROM imageapplication/x-sega-pico-rom=. sega-mega-drive-headermagic/console=   TOYS PICOSega Pico ROM imageapplication/x-sega-pico-rom=.sega-mega-drive-headermagic/console= IACSega Pico ROM imageapplication/x-sega-pico-rom=.sega-mega-drive-headermagic/console= TERA68KSega Teradrive (68K) ROM imageapplication/x-sega-teradrive-rom=.sega-mega-drive-headermagic/console= TERA286Sega Teradrive (286) ROM imageapplication/x-sega-teradrive-rom=.sega-mega-drive-headermagic/console=BRSega Mega CD Boot ROM imageapplication/x-genesis-rom=.sega-mega-drive-headermagic/consolexSega Mega Drive / Genesis ROM imageapplication/x-genesis-rom=.sega-mega-drive-headermagic/console =<NCSDmagic/console==Nintendo 3DS Game Card image>P?: "%.16s"x@(Rev.%02u)=A(New3DS only)=B(inner device)=C(Card1)=D(Card2)=E(extended device)=FNintendo 3DS eMMC dump (Old3DS)=GNintendo 3DS eMMC dump (New3DS) =HEADmagic/console= Nintendo Switch cartridge image (XCI), 1GB= Nintendo Switch cartridge image (XCI), 2GB= Nintendo Switch cartridge image (XCI), 4GB= Nintendo Switch cartridge image (XCI), 8GB= Nintendo Switch cartridge image (XCI), 16GB= Nintendo Switch cartridge image (XCI), 32GB =@ƚmagic/msdos= Windows metafile! , resource handle %#xx , bounding box (%dx ,%dx / %dx ,%d)x , dpi %u! , reserved %#xx , checksum %#x=.wmf-headmagic/msdos =@Typemagic/pascal=D2Dan Bricklin's Demo 2 demodbd=T2Turbo Pascal TOUR dataapplication/x-borland-cbtcbtx%Dan Bricklin's Demo demo (generic)dbd =.@MBMSmagic/msx=/MSX Moonblaster for MoonSound music =@ABmagic/msx= magic/msx> @MSX-BASIC extension ROM> , stahdl=%#04x> , devhdl=%#04x=OPLL, MSX-Music=PAC2 (external)=APRL (internal) = @$RBUmagic/msdos= Dell%s system BIOS= magic/msdosx0 version %d.x1 %d.x2 %d< magic/msdosx0 version %.3s =@ magic/msdos> Windows metafile=.wmf-headmagic/msdos =8WPCmagic/wordprocessors=:magic/wordprocessors= =WordPerfect macroapplication/x-wordperfect-wpmwpm= CWordPerfect help fileapplication/x-wordperfect-helpfil! I, at %#x document area= JWordPerfect keyboard fileapplication/x-wordperfect-keyboardwpkx O, %u bytes= PWordPerfect VAX keyboard definitionapplication/x-wordperfect-keyboard= V WordPerfect documentapplication/vnd.wordperfectwpd/wpt/wkb/icr/tut/sty/tst/crs= \ WordPerfect dictionary= ] WordPerfect thesaurus= ^ WordPerfect block= _WordPerfect rectangular block= `WordPerfect column block= aWordPerfect printer dataapplication/x-wordperfect-prsprs> dgA"%s"= jWordPerfect printer dataapplication/x-wordperfect-allall= oWordPerfect driver resource dataapplication/x-wordperfect-drsdrs! uF, at %#x index area= vWordPerfect Overlay fileapplication/x-wordperfect-filfil= WordPerfect graphic imageimage/x-wordperfect-graphicswpg! , at %#x document area= WordPerfect hyphenation code= WordPerfect hyphenation data= WordPerfect macro resource dataapplication/x-wordperfect-mrsmrs= WordPerfect hyphenation lex= WordPerfect wordlist= WordPerfect equation resource dataapplication/x-wordperfect-qrsqrs x magic/wordprocessors>A(...%-.19s...)x , at %#x document area= !WordPerfect spell rules= "WordPerfect dictionary rules= $WordPerfect Video Resourceapplication/x-wordperfect-vrsvrs> A"%.23s"= 'WordPerfect spell rules (Microlytics)= )WordPerfect Install optionsapplication/x-wordperfect-insins>A"%.8s"= *WordPerfect Resourceapplication/x-wordperfect-irsirs>(A"%.24s"= +WordPerfect settings file= ,WordPerfect 3.5 documentapplication/vnd.wordperfect????WPD3wpd= -WordPerfect 4.2 document= EWordPerfect dialog file= FWordPerfect Writing Toolsapplication/x-wordperfect-cbtcbd/cbt= LWordPerfect button barx magic/wordprocessorsx Corel WordPerfect: Unknown filetype %d=magic/wordprocessors= Corel shell macro= Corel shell definitionx magic/wordprocessorsx Corel Shell: Unknown filetype %d=magic/wordprocessors= Corel Notebook macro= Corel Notebook help file= Corel Notebook keyboard file= Corel Notebook definitionx magic/wordprocessorsx Corel Notebook: Unknown filetype %d=magic/wordprocessors= Corel Calculator help filex magic/wordprocessorsx Corel Calculator: Unknown filetype %d=magic/wordprocessorsx magic/wordprocessorsx Corel File Manager: Unknown filetype %d=magic/wordprocessors= Corel Calendar help file= Corel Calendar data filex magic/wordprocessorsx Corel Calendar: Unknown filetype %d=magic/wordprocessors= Corel Editor macro= Corel Editor help file= Corel Editor keyboard file= Corel Editor macro resource filex magic/wordprocessorsx Corel Program Editor/Ed Editor: Unknown filetype %d=magic/wordprocessors= Corel Macro editor macro= Corel Macro editor help file= Corel Macro editor keyboard filex magic/wordprocessorsx Corel Macro Editor: Unknown filetype %d=  magic/wordprocessorsx magic/wordprocessorsx Corel Plan Perfect: Unknown filetype %d=  magic/wordprocessors= Corel PlanPerfect macro= Corel PlanPerfect help file= Corel PlanPerfect keyboard file=  Corel PlanPerfect worksheet= Corel PlanPerfect printer definition= Corel PlanPerfect graphic definition= Corel PlanPerfect data= Corel PlanPerfect temporary printer= Corel PlanPerfect macro resource datax magic/wordprocessorsx Corel DataPerfect: Unknown filetype %d= magic/wordprocessors= Corel Mail help file= Corel Mail distribution list=  Corel Mail out box=  Corel Mail in box= Corel Mail users archived mailbox= !Corel Mail archived message database= "Corel Mail archived attachmentsx #magic/wordprocessorsx $Corel Mail: Unknown filetype %d=& magic/wordprocessors= ' Corel Printer temporary filex (magic/wordprocessorsx )Corel Printer: Unknown filetype %d=+ magic/wordprocessors= ,Corel Scheduler help file= - Corel Scheduler in file= . Corel Scheduler out filex /magic/wordprocessorsx 0Corel Scheduler: Unknown filetype %d=2magic/wordprocessors= 3 Corel GroupWise settings file= 4Corel GroupWise directory services= 5+Corel GroupWise settings filex 6magic/wordprocessorsx 7Corel WordPerfect Office: Unknown filetype %d=;magic/wordprocessors= ? WordPerfect Presentationapplication/x-drawperfect-shwshw! F, at %#x document area! H, at 0xC %#x= PCorel Presentationapplication/x-drawperfect-shwshw! W, at %#x document area! Y, at 0xC %#x! [, at 0x10 %#xx ], %u bytes= cCorel Presentation (embeded)application/x-corelpresentations/! j, at %#x document area! k, at 0xC %#x! m, at 0x10 %#xx o, %u bytesx tmagic/wordprocessorsx uCorel DrawPerfect: Unknown filetype %d=wmagic/wordprocessorsx xmagic/wordprocessorsx yCorel LetterPerfect: Unknown filetype %d={magic/wordprocessors= | Corel Terminal resource data= } Corel Terminal resource data= ~+Corel Terminal resource datax magic/wordprocessorsx Corel Terminal: Unknown filetype %d=magic/wordprocessors=  Corel loadable file=  Corel GUI loadable text=  Corel graphics resource data=  Corel printer settings file= Corel port definition file= Corel print queue parameters= Corel compressed filex magic/wordprocessorsx Corel loadable file: Unknown filetype %d=, optimized for Intel=, optimized for Non-Intel=magic/wordprocessors=  Corel Network service msg file=  Corel Network service msg file=  Corel Async gateway login msg= Corel GroupWise message filex magic/wordprocessorsx Corel Network service: Unknown filetype %d=magic/wordprocessors= GroupWise admin domain database= GroupWise admin host database= GroupWise admin remote host database= GroupWise admin ADS deferment data filex magic/wordprocessorsx GroupWise: Unknown filetype %d= magic/wordprocessors=  Corel Writing Tools User Word Listapplication/x-wordperfect-wordlistuwl/hwl/sav x magic/wordprocessors=[Pamagic/wordprocessorsx(...%-.33s...)! , at %#x document areax , %u bytes=!magic/wordprocessors=  IntelliTAG (SGML) compiled DTDx magic/wordprocessorsx IntelliTAG: Unknown filetype %d="magic/wordprocessors=  Corel WordPerfect dictionary adviseapplication/x-wordperfect-advadvx (...%-.33s...)xmagic/wordprocessorsxUnknown Corel/Wordperfect product %d,x file type %d= , v5.! , v%d.x %d =ϭmagic/windows> |MS Outlook Express DBX fileapplication/x-ms-dbxdbx=!, message database=", folder database=#, account information=$0, offline database!&, versionx (%ux *.%ux |/, ~ %u bytesx \1, highest ID %#xx 3, %u item! 5s> 7, index pointer %#x =magic/sniffer= magic/sniffer=.5view-lemagic/sniffer =typ1magic/fonts= .sfnt-fontmagic/fonts= .sfnt-namesmagic/fonts =yttcfmagic/fonts={magic/fonts ! }OTTOTrueTypefont/ttf????tfilttc = OTTOOpenTypefont/otf????OTTOttc/otcxfont collection data=, 1.0=, 2.0>, %d fonts xmagic/fonts=GISD, digitally signedx , at %#x= . sfnt-fontmagic/fonts =truemagic/fonts= . sfnt-fontmagic/fonts= . sfnt-namesmagic/fonts =qktnmagic/images=Apple QuickTake 150 Raw Image>Apple QuickTake 200 Raw Image= .quicktakemagic/images =lpushmagic/images=ngraphic-contextImageMagick Vector Graphicimage/x-mvgmvg =promagic/android= 0[0-9][0-9]Android ART profileprof=001, version 001 N=005, version 005 O=009, version 009 O MR1=010, version 010 P=015, version 015 S =prmmagic/android= 0[0-9][0-9]Android ART profile metadataprofm=001, version 001 N=002, version 002 =dey magic/android= dey [0-9]{2}Dalvik dex file (optimized for host)>000version %s = dex magic/android=  dex [0-9]{2}Dalvik dex file> 000version %s =ZJZJmagic/printer=ZZZenographics ZjStream printer data (little-endian) =iZBOTmagic/audio=jGVOX Encore music, version < 5.0 =YARAmagic/yara>  magic/yara< YARA 3.x compiled rule setx/ magic/yara= created with version 3.3.0=created with version 3.4.0= created with version 3.5.0xmagic/yaraxdevelopment version %#02x = XFSMmagic/filesystems= XFSBXFS filesystem metadump image =} XBTFmagic/archive= XBMC texture packageapplication/x-xbmc-xbtxbt! 2, version %-.1sx  , %u file>  sx , 1st %s =WXBFmagic/windows< Xmagic/windows< YMicrosoft XAML Binary Formatxbfx [%dx \.%dx ], metadata size: %d bytesx ^, node size: %d bytes =WBFSmagic/console=]Nintendo Wii disc image (WBFS format):application/x-wii-rom=.nintendo-gcn-disc-commonmagic/console =Vgm magic/audio> VGM Video Game Music dump vaudio/x-vgmvgm> %dx %dx.%d>%dx, soundchip(s)=> SN76489 (PSG),> YM2413 (OPLL),> ,YM2612 (OPN2),> 0 YM2151 (OPM),> 8 Sega PCM,> 4  magic/audio> @ RF5C68 (PCM),> 4 magic/audio> DYM2203 (OPN),> 4magic/audio> HYM2608 (OPNA),> 4magic/audio> LYM2610 (OPNB),< LYM2610B (OPNB+2FM),> 4magic/audio> PYM3812 (OPL2),> 4 magic/audio> TYM3526 (OPL),> 4$magic/audio> XY8950 (MSX-Audio),> 4(magic/audio> \YMF262 (OPL3),> 4,magic/audio> `YMF278B (OPL4),> 40magic/audio> dYMF271 (OPX),> 4 4magic/audio> h!YMZ280B (PCMD8),> 4"8magic/audio> l#RF5C164 (PCM),> 4$<magic/audio> p%PWM,> 4&@magic/audio> t'magic/audio=x(AY-3-8910,=x)AY-3-8912,=x*AY-3-8913,=x+AY-3-8930,=x,YM2149,=x-YM3439,=x.YMZ284,=x/YMZ294,> 41Lmagic/audio> 2DMG,> 43Pmagic/audio> 4NES APU,< 5NES APU with FDS,> 46Tmagic/audio> 7MultiPCM,> 48Xmagic/audio> 9uPD7759 (ADPCM Speech),> 4:\magic/audio> ;OKIM6258 (ADPCM Speech),> 4<dmagic/audio> =OKIM6295 (ADPCM),> 4>hmagic/audio> ?K051649,> 4@lmagic/audio> AK054539,> 4Bpmagic/audio> CHuC6280,> 4Dtmagic/audio> EC140,> 4Fxmagic/audio> GK053260,> 4H|magic/audio> IPokey,> 4Jmagic/audio> KQSound,> 4Mmagic/audio> NSCSP,> 4Omagic/audio> PWonderSwan,> 4Qmagic/audio> RVSU,> 4Smagic/audio> TSAA1099,> 4Umagic/audio> VES5503 (DOC),> 4Wmagic/audio> XES5505 (OTIS),< YES5506 (OTTO),> 4Zmagic/audio> [X1-010,> 4\magic/audio> ]C352,> 4^magic/audio> _GA20, =CVOX magic/games> DMagicaVoxel modelvoxx F, version %d =BUNIFmagic/console< CNES ROM image (UNIF v%d format)application/x-nes-rom =TPF0magic/msdos> Delphi compiled form '%s' =TAPEmagic/windows=magic/windows= magic/windows= $magic/windows= Windows NTbackup archivebkf=  NetWare=  NetWare SMS=  NT=  3=  OS/2=  95=  Macintosh=  UNIX! , compressed! , End Of Medium hit= magic/windows! , with catalog! , with file catalog> <, sequence %u> >, %#x encrypted! @, soft size %u*512> Dmagic/windows> Fmagic/windows=0 magic/windows> F , name: %s=0 magic/windowsx F, name: %s> Jmagic/windows=0magic/windows> J, label: %s=0magic/windowsx J, label: %sx V, software (%#x)> Pmagic/windows> R magic/windows=0"magic/windows> R#: %s=0$magic/windowsx R&: %s! T), block size %u =SSDTmagic/intel= .acpi-tablemagic/intel =ySLTGmagic/windows=$zTYPELIBType Library (legacy SLTG format) =SLICmagic/intel= .acpi-tablemagic/intel =SET magic/ispell= .spell-affmagic/ispell =eSCOWmagic/audio=fGVOX Encore music, version 5.0 or above=gGVOX Encore music, version < 5.0 =SANMmagic/animation=SHDRLucasArts Smush v2 (SANM) video =RSICmagic/rust= Rust incremental compilation metadatabinx , rustc %s = PVRTmagic/images= DDS |Sega PVR (Xbox) image:=. ms-directdraw-surfacemagic/images! SDDSega PVR image:=. sega-pvr-image-headermagic/images =hPRegmagic/windowsx iGroup Policy Registry Policy, Version=%d =PRBSmagic/console>D Nintendo Badge Arcade< magic/console< badge:> Mega Badgex (%uxx %u):> Mega Badgex (%uxx %u):xD"%s"x <, badge ID: %u>t magic/consolext, set: "%s"! magic/consolex , launch title ID: %08Xx -%08X =PMEMmagic/pmem=POOLSETPersistent Memory Poolset file= REPLICAwith replica=  LOG|BLK|OBJPersistent Memory Pool file, type: %s,>  version: %#x,x compat: %#x,x  incompat: %#x,x  ro_compat: %#x,xxcrtime: %s,xalignment_desc: %#016llx,x/magic/pmem=machine_class: 64-bit,xmachine_class: unknownx(%#d),x/magic/pmem=data: little-endian,=data: big-endian,xdata: unknownx(%#d),!reserved[0]: %d,!reserved[1]: %d,! reserved[2]: %d,!!reserved[3]: %d,x/#magic/pmem= $>machine: x86_64= %machine: aarch64x&machine: unknownx '(%#d)=)BLKmagic/pmemx *, blk.bsize: %d=,OBJmagic/pmem>-0, obj.layout: '%s'<.0, obj.layout: NULL =PKmagic/kml= magic/kml=!doc.kmlCompressed Google KML Document, including resources.application/vnd.google-earth.kmz =PIRSmagic/console=Microsoft Xbox 360 package (non-Xbox Live)=.xbox-360-packagemagic/console =PCjrmagic/pcjr=UPCjr Cartridge image=UPCjr Cartridge image =lPAGEmagic/windows=nDUMPMS Windows 32bit crash dumpapplication/x-ms-dmpdmpx t, version %ux v.%u! L, MachineImageType %#xx $, %u processors=\, no PAE=\, PAE= , full dump= , kernel dump= , small dump> , dump type (%#x)x h, %d pages=DU64MS Windows 64bit crash dumpapplication/x-ms-dmpdmpx , version %ux .%u! 0d, MachineImageType %#xx 4, %u processorsx ,= full dump= kernel dump= small dumpxDumpTypex (%#x)x, %lld pages =PACKmagic/pack< magic/pack=  ::magic/packx Git packapplication/x-gitpackx, version %ux, %u objects< "magic/pack> &ADFS PackDir archive (RISC OS)x * , LZW %u-bits compressionapplication/x-acorn-68Epkd/binx 0, root "%s"x 2, load address %#xx 4, exec address %#xx 6, attributes %#x x:, 1st object "%s"< Bmagic/pack = 7FQuake I or II world or extensionapplication/x-dzippakx K@, %u filesx M, offset %#x= . Opak-entrymagic/pack =NGmagic/msdos= Norton Guideapplication/x-norton-guideng/hlp>"%-.40s">0, %-.66s>r%-.66s =;MOOFmagic/apple=< Apple Macintosh MOOF Disk Image= =INFOmagic/apple=>, SSDD GCR (400K)=?, DSDD GCR (800K)=@, DSHD MFM (1.44M)=A, write protected=B, cross track synchronizedxC , %.32s =MCFGmagic/intel= .acpi-tablemagic/intel =LIVEmagic/console=Microsoft Xbox 360 package (Xbox Live)=.xbox-360-packagemagic/console =JZJZmagic/printer=ZZZenographics ZjStream printer data (big-endian) =INPSmagic/printer=.hpglmagic/printer = ID;Pmagic/sylk>spreadsheet interchange documentapplication/x-sylkslk/sylk>, created by=GnumericGnumeric=pmwPlanMaker= CALCOOO32Libre/OpenOffice Calc=SCALC3StarOffice Calc=XLExcel=WXLExcel=MPMultiplanx!magic/sylkx"%s =0GRIBmagic/meteorological=1Gridded binary (GRIB) version 1application/grib;edition=1grb/grib=4Gridded binary (GRIB) version 2application/grib;edition=2grb2/grib2 = GCIXmagic/images= GVRTSega GVR image:=. sega-gvr-image-headermagic/imagesx , global index = %u = GBIXmagic/images= PVRTmagic/images= DDS |Sega PVR (Xbox) image:=. ms-directdraw-surfacemagic/images! SDDSega PVR image:=. sega-pvr-image-headermagic/imagesx  , global index = %u= GVRTSega GVR image:=. sega-gvr-image-headermagic/imagesx , global index = %u =FRM8magic/audio = FOR1magic/erlang= BEAMErlang BEAM file =FLAGmagic/ispell= magic/ispell= .spell-affmagic/ispell= magic/ispell= .spell-affmagic/ispell =FILEmagic/fonts=PFF2magic/fonts=magic/fonts= NAMEGRUB2 fontapplication/x-font-pf2pf2>magic/fonts>"%-s" =UFDSmagic/console=V*NINTENDO-HVC*Famicom Disk System disk image:application/x-fds-disk=.Xnintendo-fds-disk-info-blockmagic/console=Y(%u side)!Z(%u sides) = FACPmagic/intel= . acpi-tablemagic/intel =YESVGmagic/games= Zmagic/games= [TOCEmpire Deluxe for DOS saved game =DSDTmagic/intel= .acpi-tablemagic/intel =CRIDmagic/animation= @UTFScaleform video =_CIV5magic/games=`Sid Meier's Civilization V saved game,=  a[0-9a-z.]+saved by game version %s=bSid Meier's Civilization V replay data,=  c[0-9a-z.]+saved by game version %s =YCISOmagic/console<[magic/console= \CSO v1 disk imageapplication/x-compressed-isociso/csox_, original size %llu bytesx `, datablock size %u bytes=bmagic/console= cmagic/console= dCSO v2 disk imageapplication/x-compressed-isociso/csoxg, original size %llu bytesx h, datablock size %u bytes= p magic/console=qmagic/console=r=3Nintendo GameCube disc image (CISO format):application/x-wii-rom=.tnintendo-gcn-disc-commonmagic/console=u]Nintendo Wii disc image (CISO format):application/x-wii-rom=.wnintendo-gcn-disc-commonmagic/console! magic/console!  magic/console! magic/console! @Compressed ISO CD image = CDFmagic/images>  NetCDF Data Format data (64-bit offset)application/x-netcdfnc = CDFmagic/images>  NetCDF Data Format dataapplication/x-netcdfnc =CABSmagic/console>, Nintendo Badge Arcade badge set:x,"%.48s"x $, set ID: %u =:BUFRmagic/meteorological=;Binary Universal Form data (BUFR) Edition 3application/bufrbufr=>Binary Universal Form data (BUFR) Edition 4application/bufrbufr =KBKHDmagic/games< MWwise SoundBank (little-endian)bnk= .Owwise_bkhdmagic/games<QWwise SoundBank (big-endian)bnk= .S^wwise_bkhdmagic/games =HBCFmagic/bioinformatics> Jmagic/bioinformatics> LSAMtools BCF (Binary Call Format)> Nmagic/bioinformatics=P##samtoolsVersion=magic/bioinformaticsxQ, generated by SAMtools version %s =/BB3Dmagic/games> 0magic/games> 1Blitz3D Modelb3dx 3, version %d =)AWBMmagic/images< +Award BIOS Logo, version 2image/x-award-bioslogo2epa/bmp= 1magic/imagesx 2, %dx 3x %d> 4,= 5magic/imagesx 6%d+3= 7magic/imagesx 8%d+2= 9magic/imagesx :%d+1x ;x %d = AUX magic/gentoo=. gentoo-manifestmagic/gentoo =APICmagic/intel= .acpi-tablemagic/intel =ANIMmagic/animation=AHDRLucasArts Smush Animation Format (SAN) video =AKPKmagic/games< Wwise Audio Package (little-endian)pck<Wwise Audio Package (big-endian)pck =@HD magic/bioinformatics=VN:Sequence Alignment/Map (SAM), with header=[0-9.]+ version %s =6;ELCmagic/lisp>8Emacs/XEmacs v%d byte-compiled Lisp dataapplication/x-elcEMAxTEXTelc =8BPSmagic/images>Adobe Photoshopimage/vnd.adobe.photoshop????8BPS=magic/images="PHUTImage (PhotoDeluxe)pddx"Imagepsd=Image (PSB)psbx, %d xx%d,=bitmap=grayscale= with alpha= indexed= RGB= A= CMYK= A=multichannel=duotone= lab> magic/imagesx , %dx= ,x%d-bit channel> s!, at offset 6x0x%8.8xx%4.4x =0~magic/microfocus=$>Micro Focus File with Header (DAT)application/octet-stream = 0|magic/microfocus=$ >Micro Focus File with Header (DAT)application/octet-stream =-(*^ magic/mathematica=..wolframmagic/mathematica =0$SDImagic/windows=10001System Deployment Imageapplication/x-ms-sdisdi!7, MDBtype %#llx!9, BootCodeOffset %#llx!;, BootCodeSize %#llx! =, VendorID %#llx!(?, DeviceID %#llx!0A, DeviceModel %#llx!8B%llx!@D, DeviceRole %#llx!PH, RuntimeGUID %#llx!XI%llx!`K, RuntimeOEMrev %#llx!pO, PageAlignment %lluxS, checksum %#llx>U, type %-3.8s! W(%#llx)!Y%#llx attributesx[at %#llx>]%llu bytes x) ^magic/windows>@`, type %-3.8s!(a(%#llx)!Hc%#llx attributesxPeat %#llx>Xf%llu bytes x) Pgmagic/windows>i, type %-3.8s = magic/commands< ksh byte-code version %d = magic/mmdf=b@From MMDF mailboxmessage/x-mmdf/mmdf =8magic/maple=:versionMaple help databaseapplication/x-maple-hdbhdbx@magic/maple=CAMapleMaple help databaseapplication/x-maple-hdbhdb = magic/fonts= .sfnt-fontmagic/fonts= .sfnt-namesmagic/fonts =magic/apple>magic/apple< magic/apple= magic/apple= .apple-rsrmagic/apple! magic/apple =magic/apple= .apple-rsrmagic/apple =magic/apple= .apple-rsrmagic/apple = ?fUmagic/xilinx= $@XNLXXilinx Boot Image= A, 32-bit= B, 64-bit= (C, unencrypted= (Då, black key in efuse= (Eå, obfuscated key in efuse= (FZ<\:, red key in bbram= (Gå, efuse red key in efuse= (H|\, obfuscated key in boot header= (Iå, user key in boot header= (JS|\, black key in boot header= ,K, Zynq 7000 SoCapplication/x-xilinx-boot-zynq> 4M, FSBL size %#x bytes! ,N, Zynq UltraScale+ MPSoCapplication/x-xilinx-boot-zynqmp> 4P, PMU size %#x bytes> <Q, FSBL size %#x bytes = uܧmagic/archive> wZoo archive dataapplication/x-zoozoo/bak>|0, v%c.>}/%c>~/%c!  Archive., at 8xtext "%0.10s"> , modify: v%dx!.%d+x , extract: v%ux .%u+> magic/archive!", header type %u> #, at %dx '%u bytes comment < # magic/archive < # magic/archivex #%s < magic/archive < magic/archive >037%s!), vdata %#xx ; at %u ! type=%u x method== not-compressed= lzd= lzhx , next entry at %ux , CRC %#4.4x>  , at %#x > $%u bytes commentx "%s"x , size %u x (%u compressed)= , deleted! , structuredx &, %0.13s = magic/archive > 3magic/archive > 8magic/archivex :"%s" > 9magic/archive x 7magic/archivexin "%s"! 5, time zone %d/4x6 , modified %sx9 %s = Wmmagic/epoc= XPsion Series 5 Application Installerapplication/x-epoc-sis = ]magic/compress= magic/compress=.lzmamagic/compress= magic/compress=.lzmamagic/compress = 5P*Mmagic/compressx) 6magic/compress = .vmagic/apt< / APT cache data, version %ux 0.%u, 32 bit little-endian=.1^apt-cache-32bit-bemagic/apt>2 APT cache data, version %ux3.%u, little-endian= .4^apt-cache-bemagic/apt = magic/efi= Universal EFI binary with 1 architecture= , i386= , x86_64=  Universal EFI binary with 2 architectures= , i386= , x86_64=  , i386= , x86_64> Universal EFI binary with %d architectures = vmagic/firmware=  |Frontier Silicon firmware downloadx  , MeOS version %xx , version %sx( @ , customization %s = UBI#magic/filesystems<  magic/filesystems= magic/filesystems=  magic/filesystemsx  UBI image, version %u = ?_magic/windows =  ;)MS=bmfWindows help annotationapplication/x-winhelpann!bmfmagic/windows= e|PeteWindows help Global Indexapplication/x-winhelpgidx e#magic/windows='pûlmagic/windows= .(help-ver-datemagic/windows! )magic/windows=+lmagic/windows= .,help-ver-datemagic/windows! -magic/windows=/4lmagic/windows = .0help-ver-datemagic/windows ! 1magic/windows =2:Glmagic/windows = .3help-ver-datemagic/windows ! 4magic/windows =5slmagic/windows = .6help-ver-datemagic/windows ! 7magic/windows=80vlmagic/windows= .9help-ver-datemagic/windows! :magic/windows=;\lmagic/windows= .=help-ver-datemagic/windows! >magic/windows=?\lmagic/windows= .@help-ver-datemagic/windows! Amagic/windows=B4lmagic/windows= .Chelp-ver-datemagic/windows! Dmagic/windows=Elmagic/windows= .Fhelp-ver-datemagic/windows! Gmagic/windows=H୸lmagic/windows= .Ihelp-ver-datemagic/windows! Jmagic/windows=Kqlmagic/windows= .Lhelp-ver-datemagic/windows! Mmagic/windows=Nqlmagic/windows= .Ohelp-ver-datemagic/windows! Pmagic/windows! RWindows Multimedia Viewer Bookapplication/x-winhelpmvb=VIlmagic/windowsxYWindows help Bookmarkapplication/x-winhelp/bmk !  ;)MS Windows Multimedia Viewer Bookmvbx (damaged or use higher '-P bytes' option)x , %d bytes = 1magic/filesystems=  UBIfs imagex , sequence number %llux  , length %ux  , CRC %#08x = !BDNmagic/windowsxMicrosoft Outlookapplication/vnd.ms-outlook= BAPersonal Address Bookpab= SMPersonal Storagepst= SOOffline Storageostx (< <=2002, ANSI,> >=2003, Unicode,x version %u)>, bPlatformCreate=%u>, bPlatformAccess=%u! , dwReserved1=%#x! , dwReserved2=%#x< magic/windows! , dwUnique=%#x! , dwReserved=%#xx , %u bytes!, bSentinel=%#x>, bCryptMethod=%u> magic/windows!, bidUnused=%#16.16llx! (, dwUnique=%#xx, %llu bytes!, bSentinel=%#x>, bCryptMethod=%ux , CRC32 %#x = =Omagic/elf= PS4 Signed ELF file=, SELF/SPRX signed-elf/prx=, SRVK signed-revoke-list=, SPKG signed-package=, SSPP signed-security-policy-profile=, SDIFF signed-diff=, SPSFO signed-param-sfox , version %#x = , game= , module= , video app= , System/EX application=  , System/EX module/dll = qmagic/msdos= r Windows Recycle Bin INFO2 file (Win2k - WinXP) = nmagic/msdos= oWindows Recycle Bin INFO2 file (Win98 or below) = }magic/fonts= h~X11 SNF font data, LSB firstapplication/x-font-sfnsnf =  magic/console= Nintendo GameCube disc image (GCZ format)application/x-gamecube-rom= Nintendo Wii disc image (GCZ format)application/x-wii-romxNintendo GameCube/Wii disc image (GCZ format) = &magic/vacuum-cleaner= 'dmagic/vacuum-cleaner= ('magic/vacuum-cleaner= )2magic/vacuum-cleaner= *Pmagic/vacuum-cleaner= +dmagic/vacuum-cleaner= ,magic/vacuum-cleaner= -magic/vacuum-cleaner= $. magic/vacuum-cleaner = (/dmagic/vacuum-cleaner x 0LG robot VR6[234]xx %dm^2 navigation = h1reuse map data = h2map data > h3spurious map data < h4spurious map data = magic/forth= magic/forth> ARM OpenFirmware FORTH Dictionary,x Text length: %d bytes,x Data length: %d bytes,x Text Relocation Table length: %d bytes,x $Data Relocation Table length: %d bytes,x (Entry Point: %#08X,x ,BSS length: %d bytes =magic/blackberry= BlackBerry RIM ETP filex for %s =pmagic/filesystems=GFS1 Filesystemx$(blocksize %d,>`lockproto %s)= GFS2 Filesystemx$(blocksize %d,>`lockproto %s) = Vmagic/psdbms= ^[0-9]ps database> version %s>from kernel %s =!ECImagic/audio=(NDHSNDH Atari ST music=(TITLSNDH Atari ST music =rmagic/apple> tApplesoft BASIC program data, first line number %d = magic/pbf= magic/pbf=  OSMHeaderOpenStreetMap Protocolbuffer Binary Format =< magic/sql==MACFMySQL Maria control filex>Version %d =Amagic/animation=BMPEG sequencevideo/mpegvob/evo/mpg/mpeg&G@, v2, program multiplex^H@, v1, system multiplex=IMPEG sequence, v1/2, multiplex (missing pack header)=JMPEG sequence, H.264 video=KB, baseline=LM, main=MX, extendedxN @ L %u=PMPEG sequence, v4video/mpeg4-generic=Tmagic/animation& Umagic/animation= V, video= W , still texture= X0, mesh= Y@, face= Z, video= [, still texture= \, mesh= ] , face=^, simple @ L1=_, simple @ L2=`, simple @ L3=a, simple @ L0=b, simple scalable @ L1=c, simple scalable @ L2=d!, core @ L1=e", core @ L2=f2, main @ L2=g3, main @ L3=h5, main @ L4=iB, n-bit @ L2=jQ, scalable texture @ L1=ka, simple face animation @ L1=lb, simple face animation @ L2=mc, simple face basic animation @ L1=nd, simple face basic animation @ L2=oq, basic animation text @ L1=pr, basic animation text @ L2=q, hybrid @ L1=r, hybrid @ L2=s, advanced RT simple @ L!=t, advanced RT simple @ L2=u, advanced RT simple @ L3=v, advanced RT simple @ L4=w, core scalable @ L1=x, core scalable @ L2=y, core scalable @ L3=z, advanced coding efficiency @ L1={, advanced coding efficiency @ L2=|, advanced coding efficiency @ L3=}, advanced coding efficiency @ L4=~, advanced core @ L1=, advanced core @ L2=, advanced scalable texture @ L1=, advanced scalable texture @ L2=, advanced scalable texture @ L3=, simple studio @ L1=, simple studio @ L2=, simple studio @ L3=, simple studio @ L4=, core studio @ L1=, core studio @ L2=, core studio @ L3=, core studio @ L4=, advanced simple @ L0=, advanced simple @ L1=, advanced simple @ L2=, advanced simple @ L3=, advanced simple @ L4=, advanced simple @ L5=, advanced simple @ L3b=, FGS @ L0=, FGS @ L1=, FGS @ L2=, FGS @ L3=, FGS @ L4=, FGS @ L5=MPEG sequence, v4video/mpeg4-generic&magic/animation=, video (missing profile header)= , still texture (missing profile header)=0, mesh (missing profile header)=@, face (missing profile header)=, video (missing profile header)=, still texture (missing profile header)=, mesh (missing profile header)= , face (missing profile header)=MPEG sequencevideo/mpeg= , v1, progressive Y'CbCr 4:2:0 video= , v1, progressive Y'CbCr 4:2:0 video= , v2,= HP= Spt= SNR= MP= SP=@@HL=`@H-14=@ML=@LL& progressive^ interlaced= Y'CbCr 4:2:0 video= Y'CbCr 4:2:2 video= Y'CbCr 4:4:4 video& magic/animation&Kmagic/animation=, v1, progressive Y'CbCr 4:2:0 video=, v1, progressive Y'CbCr 4:2:0 video=, v2,= HP= Spt= SNR= MP= SP=@@HL=`@H-14=@ML=@LL& progressive^ interlaced= Y'CbCr 4:2:0 video= Y'CbCr 4:2:2 video= Y'CbCr 4:4:4 video=L, v1, progressive Y'CbCr 4:2:0 video=L, v1, progressive Y'CbCr 4:2:0 video=L, v2,=P HP=P Spt=P SNR=P MP=P SP=Q@@HL=Q`@H-14=Q@ML=Q@LL&Q progressive^Q interlaced=Q Y'CbCr 4:2:0 video=Q Y'CbCr 4:2:2 video=Q Y'CbCr 4:4:4 video=8x, HD-TV 1920P=, 16:9=-P, SD-TV 1280I=, 16:9=@0, PAL Capture=, 4:3=,, 4CIF= NTSC=@ PAL= , 4:3=0, 16:9=@, 11:5=, PAL 4:3=, NTSC 4:3=(, LD-TV 640P=, 4:3=, 320x240=, 4:3=, 240x160=, 4:3=x , 160x120=, 4:3=, CIF= NTSC=  PAL= , 4:3=0, 16:9=@, 11:5=, PAL 4:3=, NTSC 4:3=@ PAL 625= , 4:3=0, 16:9=@, 11:5=-, CCIR/ITU= NTSC 525=@ PAL 625= , 4:3=0, 16:9=@, 11:5=, SVCD= NTSC 525=@ PAL 625= , 4:3=0, 16:9=@, 11:5=, 23.976 fps= , 24 fps= , 25 fps= , 29.97 fps= , 30 fps= , 50 fps=, 59.94 fps=, 60 fps& , Constrained = magic/linuxxmagic/linux>Device Tree Blob version %dx, size=%d>magic/linuxx, boot CPU=%d>magic/linuxx , string block size=%d>magic/linuxx$, DT structure block size=%d =&vmagic/apt<' APT cache data, version %ux(.%u, 32 bit big-endian=.)apt-cache-32bit-bemagic/apt>* APT cache data, version %ux+.%u, big-endian= .,apt-cache-bemagic/apt =u?B<magic/adventure=v‡jAdrift game file version=wa6E3.80=xa7E3.90=ya>E4.0=za>E5.0x{unknownapplication/x-adrift =&magic/printer> *DOS EPS Binary Fileimage/x-eps>.at byte %d>0length %d x) 2magic/printer> 6at byte %deps>9length %dx) ;magic/printer>>at byte %deps/ept>Blength %dx) Dmagic/printer =#magic/cafebabe=$Mach-O universal binary with 1 architecture:application/x-mach-binary=.&mach-omagic/cafebabe>(magic/cafebabe<)Mach-O universal binary with %d architectures:application/x-mach-binary=.+mach-omagic/cafebabe>,magic/cafebabe=.-mach-omagic/cafebabe>.magic/cafebabe=.0/mach-omagic/cafebabe>0magic/cafebabe=.D1mach-omagic/cafebabe>2magic/cafebabe=.X3mach-omagic/cafebabe>4magic/cafebabe=.l5mach-omagic/cafebabe>:compiled Java class data,application/x-java-appletclassx>version %d.x?%d=G.(Java 1.2)=H/(Java 1.3)=I0(Java 1.4)=J1(Java 1.5)=K2(Java 1.6)=L3(Java 1.7)=M4(Java 1.8)=N5(Java SE 9)=O6(Java SE 10)=P7(Java SE 11)=Q8(Java SE 12)=R9(Java SE 13)=S:(Java SE 14)=T;(Java SE 15)=U<(Java SE 16)=V=(Java SE 17)=W>(Java SE 18)=X?(Java SE 19)=Y@(Java SE 20)=ZA(Java SE 21)=[B(Java SE 22)=\C(Java SE 23)=]D(Java SE 24)=^E(Java SE 25)=_F(Java SE 26) = Emagic/matroska= Bmagic/matroska=webmWebMvideo/webm=matroskaMatroska datavideo/x-matroska =8magic/console= magic/console==3Nintendo GameCube embedded disc image:application/x-gamecube-rom=.nintendo-gcn-disc-commonmagic/console =Emagic/linux=IHdrSmagic/linuxxKLinuxapplication/x-linux-kernelxOmagic/linux=QSKLEELKS Kernel/!TSKLEx86 kernel/b/bin=.Wkernel-version-old1magic/linux=Yظmagic/linux=.[kernel-version-old2magic/linux=.]kernel-version-old3magic/linux= ._kernel-infomagic/linux = magic/gnu=magic/gnu=KBXfGPG keybox database=version %dx , created-at %sx , last-maintained %s =umagic/fonts=hwX11 SNF font data, MSB firstapplication/x-font-sfnsnf =;magic/animation=<JVT NAL sequence, H.264 video==B, baseline=>M, main=?X, extendedx@ @ L %u =magic/msdos> magic/msdos<  Lotus 1-2-3application/vnd.lotus-1-2-3????L123= WorKsheet, version 3wk3= WorKsheet, version 4wk4/wt4= WorKsheet, version 97123= WorKsheet, version 9.8 Millennium123=  FoRMatting datafrm= $ForMatting data, version 3fm3x&unknown= (worksheetwXX! *formatting datafXXx -, revision %#x= ., cell range! 1magic/msdos> 2%d*x 3%d,x 4%d->6%d*x 8%d,x9%d>;, character set %#xx=, flags %#x! >magic/msdos=@magic/msdos>B, 1st font "%s" =Vmagic/msdos= Wmagic/msdos= .Xcur-ico-dirmagic/msdos= Ymagic/msdos= .Zcur-ico-dirmagic/msdos = magic/msdos= magic/msdosxmagic/msdos= .cur-ico-dirmagic/msdos= magic/msdosxmagic/msdos= .cur-ico-dirmagic/msdos =!magic/console="magic/console=#magic/console=$]Nintendo Wii SDK disc image:application/x-wii-rom=.&nintendo-gcn-disc-commonmagic/console='=3Nintendo GameCube SDK disc image:application/x-gamecube-rom=.)nintendo-gcn-disc-commonmagic/console =1magic/msdos>Microsoft= `Wordapplication/mswordMSWDWDBNdoc/dcx=n1.0-4.0!n5.0-6.0xn(DOS) Document! `Write 3.0 (Windows) Documentapplication/x-mswriteMSWDWDBNwri/doc x magic/msdos= magic/msdosx%sx, author %sx, reviser %sx, keywords %sx, comment %s x, version %s x, %-.8s x created %-.8s>0, formatted by %-.66s> `, %u pages>b0, %-.8s printer> j, %u blocksx,>magic/msdosx%s< magic/msdos>magic/msdosx%s< magic/msdos>magic/msdosx%s< magic/msdos>magic/msdosx%s< magic/msdos>magic/msdosx%s< magic/msdos>magic/msdos x%s =RMPmagic/apple= .Uapple-apmmagic/apple =magic/sinclair<magic/sinclair<magic/sinclair<magic/sinclair<QL OS dump data,>type %.3s,>version %.4s =magic/vms=VMS Alpha executable=&PK, Info-ZIP SFX archive v5.12 w/decryption =magic/msdos=2Microsoft Word for Macintosh 1.0application/mswordmcw=4Microsoft Word for Macintosh 3.0application/mswordmcw=7Microsoft Word for Macintosh 4.0application/mswordmcw=#7Microsoft Word for Macintosh 5.0application/mswordmcw ='magic/xilinx=(fUXilinx RAW bitstream (.BIN) =4magic/virtual=(5_FVHmagic/virtual=d6Umagic/virtual=.7virtualbox-nvrammagic/virtual=GBMBPHP phar archive=with MD5 signaturephar=with SHA1 signaturephar=with SHA256 signaturephar=with SHA512 signaturephar=with OpenSSL signaturephar=with OpenSSL SHA256 signaturephar=with OpenSSL SHA512 signaturephar@= +Z protectedmagic/c-lang=[^[[:space:]]*protected:C++ source texttext/x-c++@= +< namespacemagic/c-lang=6=^namespace[[:space:]]+[_[:alpha:]]{1,30}[[:space:]]*\{C++ source texttext/x-c++@=+& D), major %u> F*, minor %u>+(%s)xp,, %lld bytes(= RenderWare data, v3.4.0.5, used in GTA III/VC on Android,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.6.0.3, used in GTA SA,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.4.0.3, used in GTA VC PC,= texture archive (TXD)= 3D models (DFF)(=  RenderWare data, v3.3.0.2, used in GTA III PC and GTA VC PS2,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.1.0.1, used in GTA III on PC/PS2,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.5.0.0, used in GTA III/VC on Xbox,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.4.0.0,= texture archive (TXD)= 3D models (DFF)(=  RenderWare data, v3.3.0.0,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.2.0.0, used in GTA III on PC,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.1.0.0, used in GTA III on PS2,= texture archive (TXD)= 3D models (DFF)(= GEM Metafile datax version %d(= |pxelinux loader (version 2.13 or older)(= pxelinux loader (version 3.70 or newer)(= òpcap capture file, microsecond ts (little-endian)application/vnd.tcpdump.pcap=.!^pcap-bemagic/sniffer(= / h:DCX multi-pageimage/x-dcxdcxx 5 , at %#x x) 6 magic/images(= SiGTA Ped and LOD models (WDD), used in GTA IV(= SiGTA Windows Texture Dictionary (WTD), used in GTA IV(= A *_Cineon image data>B , %d x>C %d(= k v/1OpenEXR image data,image/x-exrx m version %d,^ n storage: scanline& o storage: tiled= p compression, compression: =q none =r rle =s zips =t zip =u piz =v pxr24 =w b44 =x b44a =y dwaa =z dwab >{ unknown= | dataWindow, dataWindow: x } (%d x ~ %d)-x  (%d x  %d)= displayWindow, displayWindow: x (%d x  %d)-x  (%d x  %d)=  lineOrder, lineOrder: = increasing y = decreasing y = random y > unknown(= scrGTA script (SCO), encrypted, used in GTA IVx %d code bytes,x %d static variables,x %d global variables(= ff`pxelinux loader(= z `MDEC video stream,x { %dxx | %d(= TRiGTA Drawable data (WDR), model and weapon data, used in GTA IV(= SCR GTA script (SCO), unencrypted, used in GTA IV,x %d code bytes,x %d static variables,x %d global variables(= R*NGTA archive (IMG),x version %d, used in GTA IV,x %d items(= PGTA1 style data (G24), 24 bit in-game graphics(= 'M<pcap capture file, nanosecond ts (little-endian)application/vnd.tcpdump.pcap=.)^pcap-bemagic/sniffer(= KGTA1 map layout (CMP),=Level 1=Level 2=Level 3(= EGTA1 style data (GRY), 8 bit in-game graphics(= 8RiGTA Windows Frag Type (WFT), vehicle models, used in GTA IV(= 04Ͳpcap capture file, microsecond ts, extensions (little-endian)=.1^pcap-bemagic/sniffer(= "GTA1 style data (GRX), 8 bit editor graphics(= \ASTCx%uxx%u>x%ux texture, %ux x %u> x %u(= fontconfig cache file (mmap):= .fc-cache-lemagic/fonts(= fontconfig cache file:= .fc-cache-lemagic/fonts(=  Android package resource table (ARSC)arsc! , %d packages= magic/android! , %d string(s)! , %d style(s)& , sorted& , utf8(=eLWCorel Draw Pictureapplication/vnd.corel-drawcdr=!e, version 1.0=&m, version 2.0(=ZLepton image filex(version %d)(= Norton GHost image= , first file= , split filex id=%#x= , no compression= , fast compression (Z1)= , medium compression (Z2)> magic/archive< , compression (Z%d-1)=! magic/archive! # , password protected!,$ magic/archive= & , sector copy=+( , boot track=,* , disc sector copy>, "%-.254s"=. `Umagic/archivex)/ ; contains(= Common Data Format (Version 2.5 or earlier) dataapplication/x-cdf(=ZقWii U firmware image:= [ARM=\!, NAND boot=]", SD boot=^, for devkits=_, for retail= `PowerPC=a, Wii U mode=b, Wii mode(=òpcap capture file, microseconds ts (big-endian)application/vnd.tcpdump.pcap=.pcap-bemagic/sniffer(=wWarpIN Installerapplication/x-os2-wpiwpix, created by %sxF, '%s'x, URL %s(=C MS Outlook Nickfileapplication/x-ms-nickfilenk2/dat/bakx K, probably version %ux M.%ux O, %u itemsx Q, %u entriesx S, value type %#4.4xx U, entry type %#4.4x= [magic/windowsx $], %u bytesx(_"%s"(=4jYSun raster image data>5, %d x>6%d,> 7%d-bit,=9old format,=;compressed,=<RGB,==TIFF,=>IFF,=?reserved for testing,=@no colormap=ARGB colormap=Braw colormap(=$M<pcap capture file, nanosecond ts (big-endian)application/vnd.tcpdump.pcap=.&pcap-bemagic/sniffer(=/JxHCrunch compressed texture:x 0%u xx1%u=2, DXT1=3, DXT3=4, DXT5=5, DXT5 CCxY=6, DXT5 xGxR=7, DXT5 xGBR=8, DXT5 AGBR=9, DXn XY=:, DXn YX=; , DXT5 Alpha=< , ETC1>=, %u images>>, %u faces(=.4Ͳpcap capture file, microsecond ts, extensions (big-endian)=./pcap-bemagic/sniffer(=fontconfig cache file (mmap):= .fc-cache-bemagic/fonts(=fontconfig cache file:= .fc-cache-bemagic/fonts(= `Common Data Format (Version 2.6 or 2.7) dataapplication/x-cdf(= Hierarchical Data Format (version 4) dataapplication/x-hdfhdf/hdf4/h4(= Common Data Format (Version 3 or later) dataapplication/x-cdf(=",Microsoft Publisher (1.0)application/vnd.ms-publisherpub(= ɸInstallShield Scriptapplication/x-installshield-insinsx &"%s"=(!SRCDIR, variable names:x *#%ux +%sx -#%ux .%sx 0#%ux 1%sx?... =-Imagic/msdos=Nmagic/msdos>PLotusapplication/vnd.lotus-1-2-3????L123= V1-2-3 CoNFiguration, version 2.x (PGRAPH.CNF)cnf= X 1-2-3 CoNFiguration, version 2.4Jcnf= Z1-2-3 CoNFiguration, version 1-2.1cnf= \Symphony CoNFigurationcnf= ^1-2-3 CoNFiguration, version 2.2cnf= ` 1-2-3 CoNFiguration, version 2.3-2.4cnf= b1-2-3 CoNFiguration, version 3.xcnf= dP1-2-3 CoNFiguration, version 4.xcnf= h1-2-3 WorKSheet, version 1wks= mSymphony WoRksheet, version 1.0wrk/wr1= q1-2-3/Symphony worksheet, version 2wk1/wr1= u1-2-3 WorKsheet, version 1.xJwj1= {1-2-3 worksheet, version 2.4Jwj3= ~1-2-3 ForMaTting data, version 2.xfmt/fj3= 1-2-3 FoRMatting data, version 2.0frmxunknown worksheet or configurationcnfx , revision %#x= .lotus-cellsmagic/msdos= .  lotus-cellsmagic/msdos =MAP CCP4 Electron Density Map= , Big-endian=!", VAX format="D, Little-endian=#U, Convex native =OS/2OS/2 Boot Manager =DICMDICOM medical imaging dataapplication/dicomdcm/dicom/dic =Xni1NIfTI-1 neuroimaging data header,image/x.niftihdr=.nifti1magic/nifty =X n+1NIfTI-1 neuroimaging data,image/x.niftinii=. nifti1magic/nifty =TXUltrix core file>Xfrom '%s' =LSCRSScream Tracker Sample=sample=adlib melody>adlib drum&stereo^mono&16bit little endian^8bit=unpacked=packed =<zTXTA GutenPalm zTXT e-book>"%s"=Nmagic/palmxN(v0.%02d)=Nmagic/palmxN(v1.%02d)>N magic/palm<N - 1 bookmark>N - %d bookmarks>Nmagic/palm<N- 1 annotation>N- %d annotations>N(v%d.xN%02d) =<ptchPalm OS operating system patch data>"%s" =<SONGSoundFX Module sound file =<oIM10Imago Orpheus module sound data ->p"%s" =8OKTA8-channel Octalyzer module sound dataaudio/x-mod>Title: "%s" =8M.K.4-channel Protracker module sound dataaudio/x-mod>Title: "%s" =8M!K!4-channel Protracker module sound dataaudio/x-mod>Title: "%s" =8FLT88-channel Startracker module sound dataaudio/x-mod>Title: "%s" =8FLT44-channel Startracker module sound dataaudio/x-mod>Title: "%s" =8CD818-channel Octalyser module sound dataaudio/x-mod>Title: "%s" =88CHN8-channel Fasttracker module sound dataaudio/x-mod>Title: "%s" =86CHN6-channel Fasttracker module sound dataaudio/x-mod>Title: "%s" =84CHN4-channel Fasttracker module sound dataaudio/x-mod>Title: "%s" =832CN32-channel Taketracker module sound dataaudio/x-mod>Title: "%s" =816CN16-channel Taketracker module sound dataaudio/x-mod>Title: "%s" =8!PM!4-channel Protracker module sound dataaudio/x-mod>Title: "%s" =8RSCLinux kernel RISC-V boot executable Image^ , little-endian& , big-endian =,SCRMScreamTracker III Module sound data>Title: "%s"audio/x-s3m =,PTMFPoly Tracker PTM Module>Title: "%s" = NXSBApple File System (APFS)x $, blocksize %u =/GPATGIMP pattern data,x0%simage/x-gimp-patpat =9GIMPGIMP brush dataimage/x-gimp-gbrgbr = SNDHSNDH Atari ST music = DSD DSDIFF audio bitstream dataaudio/x-dffdff=FVERmagic/audio=magic/audiox, 1 bit=PROPmagic/audio=SNDmagic/audio=CHNLmagic/audio=, mono =magic/audio=SLFTSRGT, stereox, 2 channels =magic/audio= SLFTSRGTLFE , 2.1 stereo= SLFTSRGTC , 3.0 stereox, 3 channels =magic/audio=MLFTMRGTLS RS , 4.0 surround=SLFTSRGTC LFE , 3.1 stereox, 4 channels =magic/audio=MLFTMRGTC LS RS , 5.0 surround=MLFTMRGTLFE LS RS , 4.1 surroundx, 5 channels =magic/audio=MLFTMRGTC LFE LS RS , 5.1 surroundx, 6 channels>, %u channels=FS magic/audiox, =Dmagic/audioxD"DSD %u"x%u Hz=CMPRmagic/audio=DSD , no compression=DST , DST compressionx, unknown compressionxmagic/audio=DIINmagic/audio>, "edited master" metadata=ID3 magic/audio=ID3, ID3 version 2x.%ux.%ux, ID3 missing (or unreachable)x, unknown version = BB02Bacula volumex  , started %s = PSURARC archive (c64) =RB40RBS Song file=ReBorncreated by ReBorn= %Propellerheadcreated by ReBirth =nDUCKDuckDB database filex o, version %lld =DEEPAlias Maya Image File =CIMGAlias Maya Image File =.FITFIT Map data= magic/mapx# , unit id %dx ' , serial %ux+L%, %sx /, manufacturer %d= / (garmin)x 1, product %dx5, type %d=5 (Device)=5 (Settings)=5 (Sports/Cycling)=5 (Activity)=5 (Elevations)=5 (Totals) =wideApple QuickTime movie (unoptimized)video/quicktime =pckgApple QuickTime compressed archiveapplication/x-quicktime-player = moovApple QuickTimevideo/quicktime= mvhd movie (fast start)= mdra URL= cmov movie (fast start, compressed header)= rmra multiple URLs =mdatApple QuickTime movie (unoptimized)video/quicktime =idscApple QuickTime image (fast start)image/x-quicktime =%ftypISO Media='XAVC, MPEG v4 system, Sony XAVC Codecvideo/mp4x`), Audio "%.4s"xv*at %dHzx+, Video "%.4s"x,%dx-x%d=.3g2, MPEG v4 system, 3GPP2video/3gpp2= 0 v4 (H.263/AMR GSM 6.10)= 1 v5 (H.263/AMR GSM 6.10)= 2 v6 (ITU H.264/AMR GSM 6.10)= 5a C.S0050-0 V1.0= 6b C.S0050-0-A V1.0.0= 7c C.S0050-0-B V1.0=83ge, MPEG v4 system, 3GPPvideo/3gpp= :, Release %d MBMS Extended Presentations= ;, Release %d MBMS Extended Presentations= < , Release %d MBMS Extended Presentations==3gf, MPEG v4 system, 3GPP= > , Release %d File-delivery profile=?3gg, MPEG v4 system, 3GPPvideo/3gpp= A, Release %d General Profile= B , Release %d General Profile=C3gh, MPEG v4 system, 3GPPvideo/3gpp= E , Release %d Adaptive Streaming Profile=F3gm, MPEG v4 system, 3GPPvideo/3gpp= H , Release %d Media Segment Profile=I3gp, MPEG v4 system, 3GPPvideo/3gpp= K, Release %d (non existent)= L, Release %d (non existent)= M, Release %d (non existent)= N, Release %d= O, Release %d= P, Release %d= Q, Release %d Streaming Servers=R3gr, MPEG v4 system, 3GPPvideo/3gpp= T, Release %d Progressive Download Profile= U , Release %d Progressive Download Profile=V3gs, MPEG v4 system, 3GPPvideo/3gpp= X, Release %d Streaming Servers= Y, Release %d Streaming Servers= Z , Release %d Streaming Servers=[3gt, MPEG v4 system, 3GPPvideo/3gpp= ], Release %d Media Stream Recording Profile= ^ , Release %d Media Stream Recording Profile=_ARRI, MPEG v4 system, ARRI Digital Cameravideo/mp4=aavc1, MPEG v4 system, 3GPP JVT AVC [ISO 14496-12:2005]video/mp4=cbbxm, Blinkbox Master File: H.264 video/16-bit LE LPCM audiovideo/mp4=eqt, Apple QuickTime movievideo/quicktime=gCAEP, Canon Digital Camera=hcaqv, Casio Digital Camera=iCDes, Convergent Design=jcaaa, CMAF Media Profile - AAC Adaptive Audio=kcaac, CMAF Media Profile - AAC Core=lcaqv, Casio Digital Camera Casio=mccea, CMAF Supplemental Data - CEA-608/708=nccff, Common container file format=ocfhd, CMAF Media Profile - AVC HD=pcfsd, CMAF Media Profile - AVC SD=qchd1, CMAF Media Profile - HEVC HDR10=rchdf, CMAF Media Profile - AVC HDHF=schhd, CMAF Media Profile - HEVC HHD8=tchh1, CMAF Media Profile - HEVC HHD10=uclg1, CMAF Media Profile - HEVC HLG10=vcmfc, CMAF Track Format=wcmff, CMAF Fragment Format=xcmfl, CMAF Chunk Format=ycmfs, CMAF Segment Format=zcud1, CMAF Media Profile - HEVC UHD10={cud8, CMAF Media Profile - HEVC UHD8=|cwvt, CMAF Media Profile - WebVTT=}da0a, DMB MAF w/ MPEG Layer II aud, MOT slides, DLS, JPG/PNG/MNG=~da0b, DMB MAF, ext DA0A, with 3GPP timed text, DID, TVA, REL, IPMP=da1a, DMB MAF audio with ER-BSAC audio, JPG/PNG/MNG images=da1b, DMB MAF, ext da1a, with 3GPP timed text, DID, TVA, REL, IPMP=da2a, DMB MAF aud w/ HE-AAC v2 aud, MOT slides, DLS, JPG/PNG/MNG=da2b, DMB MAF, ext da2a, with 3GPP timed text, DID, TVA, REL, IPMP=da3a, DMB MAF aud with HE-AAC aud, JPG/PNG/MNG images=da3b, DMB MAF, ext da3a w/ BIFS, 3GPP, DID, TVA, REL, IPMP=dash, MPEG v4 system, Dynamic Adaptive Streaming over HTTPvideo/mp4=dby1, MP4 files with Dolby content=dsms, Media Segment DASH conformant=dts1, MP4 track file with audio codecs dtsc dtsh or dtse=dts2, MP4 track file with audio codec dtsx=dts3, MP4 track file with audio codec dtsy=dxo$20, DxO ONE camera=dmb1, DMB MAF supporting all the components defined in the spec=dmpf, Digital Media Project=drc1, Dirac (wavelet compression), encap in ISO base media (MP4)=dv1a, DMB MAF vid w/ AVC vid, ER-BSAC aud, BIFS, JPG/PNG/MNG, TS=dv1b, DMB MAF, ext dv1a, with 3GPP timed text, DID, TVA, REL, IPMP=dv2a, DMB MAF vid w/ AVC vid, HE-AAC v2 aud, BIFS, JPG/PNG/MNG, TS=dv2b, DMB MAF, ext dv2a, with 3GPP timed text, DID, TVA, REL, IPMP=dv3a, DMB MAF vid w/ AVC vid, HE-AAC aud, BIFS, JPG/PNG/MNG, TS=dv3b, DMB MAF, ext dv3a, with 3GPP timed text, DID, TVA, REL, IPMP=dvr1, DVB (.DVB) over RTPvideo/vnd.dvb.file=dvt1, DVB (.DVB) over MPEG-2 Transport Stream=emsg, Event message box presentvideo/vnd.dvb.file=F4V, Video for Adobe Flash Player 9+ (.F4V)video/mp4=F4P, Protected Video for Adobe Flash Player 9+ (.F4P)video/mp4=F4A, Audio for Adobe Flash Player 9+ (.F4A)audio/mp4=F4B, Audio Book for Adobe Flash Player 9+ (.F4B)audio/mp4=ifrm, Apple iFrame Specification, Version 8.1 Jan 2013=im1i, CMAF Media Profile - IMSC1 Image=im1t, CMAF Media Profile - IMSC1 Text=isc2, ISMACryp 2.0 Encrypted File=iso, MP4 Base Mediavideo/mp4mp4= mv1 [ISO 14496-12:2003]= 2v2 [ISO 14496-12:2005]= 4v4= 5v5 = 6v6 =isml, MP4 Base Media v2 [ISO 14496-12:2005]video/mp4=J2P0, JPEG2000 Profile 0=J2P1, JPEG2000 Profile 1=jp2, JPEG 2000image/jp2=JP2, JPEG 2000 Image (.JP2) [ISO 15444-1 ?]image/jp2=JP20, Unknown, from GPAC samples (prob non-existent)=jpm, JPEG 2000 Compound Image (.JPM) [ISO 15444-6]image/jpm=jpsi, The JPSearch data interchange format=jpx, JPEG 2000 w/ extensions (.JPX) [ISO 15444-2]image/jpx=KDDI, 3GPP2 EZmovie for KDDI 3G cellphonesvideo/3gpp2=LCAG, Leica digital camera=lmsg, Last Media Segment indicator for ISO base media file format.=M4A, Apple iTunes ALAC/AAC-LC (.M4A) Audioaudio/x-m4a=M4B, Apple iTunes ALAC/AAC-LC (.M4B) Audio Bookaudio/mp4=M4P, Apple iTunes ALAC/AAC-LC (.M4P) AES Protected Audiovideo/mp4=M4V, Apple iTunes Video (.M4V) Videovideo/x-m4v=M4VH, Apple TV (.M4V)video/x-m4v=M4VP, Apple iPhone (.M4V)video/x-m4v=mj2s, Motion JPEG 2000 [ISO 15444-3] Simple Profilevideo/mj2=mjp2, Motion JPEG 2000 [ISO 15444-3] General Profile=MFSM, Media File for Samsung video Metadata=MGSV, Sony Home and Mobile Multimedia Platform (HMMP)video/mj2=mmp4, MPEG-4/3GPP Mobile Profile (.MP4 / .3GP) (for NTT)video/mp4=mobi, MPEG-4, MOBI formatvideo/mp4=mp21, MPEG-21 [ISO/IEC 21000-9]=mp41, MP4 v1 [ISO 14496-1:ch13]video/mp4=mp42, MP4 v2 [ISO 14496-14]video/mp4=mp71, MP4 w/ MPEG-7 Metadata [per ISO 14496-12]=mp7t, MPEG v4 system, MPEG v7 XML=mp7b, MPEG v4 system, MPEG v7 binary XML=mpuf, Compliance with the MMT Processing Unit format=msdh, Media Segment conforming to ISO base media file format.=msix, Media Segment conforming to ISO base media file format.=mmp4, MPEG v4 system, 3GPP Mobilevideo/mp4=MPPI, Photo Player, MAF [ISO/IEC 23000-3]=mqt, Sony / Mobile QuickTime (.MQV) US Pat 7,477,830video/quicktime=MSNV, MPEG-4 (.MP4) for SonyPSPaudio/mp4=NDAS, MP4 v2 [ISO 14496-14] Nero Digital AAC Audioaudio/mp4=NDSC, MPEG-4 (.MP4) Nero Cinema Profilevideo/mp4=NDSH, MPEG-4 (.MP4) Nero HDTV Profilevideo/mp4=NDSM, MPEG-4 (.MP4) Nero Mobile Profilevideo/mp4=NDSP, MPEG-4 (.MP4) Nero Portable Profilevideo/mp4=NDSS, MPEG-4 (.MP4) Nero Standard Profilevideo/mp4=NDXC, H.264/MPEG-4 AVC (.MP4) Nero Cinema Profilevideo/mp4=NDXH, H.264/MPEG-4 AVC (.MP4) Nero HDTV Profilevideo/mp4=NDXM, H.264/MPEG-4 AVC (.MP4) Nero Mobile Profilevideo/mp4=NDXP, H.264/MPEG-4 AVC (.MP4) Nero Portable Profilevideo/mp4=NDXS, H.264/MPEG-4 AVC (.MP4) Nero Standard Profile=niko, Nikon Digital Cameravideo/mp4=odcf, OMA DCF DRM Format 2.0 (OMA-TS-DRM-DCF-V2_0-20060303-A)=opf2, OMA PDCF DRM Format 2.1 (OMA-TS-DRM-DCF-V2_1-20070724-C)=opx2, OMA PDCF DRM + XBS ext (OMA-TS-DRM_XBS-V1_0-20070529-C)=pana, Panasonic Digital Camera=piff, Protected Interoperable File Format=pnvi]b, Panasonic Video Intercom=qt, Apple QuickTime (.MOV/QT)video/quicktime= mif1, HEIF Imageimage/heif= msf1, HEIF Image Sequenceimage/heif-sequence=heic, HEIF Image HEVC Main or Main Still Picture Profileimage/heic=heix, HEIF Image HEVC Main 10 Profileimage/heic=hevc, HEIF Image Sequenz HEVC Main or Main Still Picture Profileimage/heic-sequence=hevx, HEIF Image Sequence HEVC Main 10 Profileimage/heic-sequence=heim, HEIF Image L-HEVCimage/heif=heis, HEIF Image L-HEVCimage/heif=avic, HEIF Image AVCimage/heif= hevm, HEIF Image Sequence L-HEVCimage/heif-sequence="hevs, HEIF Image Sequence L-HEVCimage/heif-sequence=$avcs, HEIF Image Sequence AVCimage/heif-sequence=(avif, AVIF Imageimage/avif=*avis, AVIF Image Sequenceimage/avif=,risx, Representation Index Segment for MPEG-2 TS Segments=-ROSS, Ross Video=.sdv, SD Memory Card Video=/ssc1, Samsung stereo, single stream (patent pending)=0ssc2, Samsung stereo, dual stream (patent pending)=1SEAU, Sony Home and Mobile Multimedia Platform (HMMP)=2SEBK, Sony Home and Mobile Multimedia Platform (HMMP)=3senv, Video contents Sony Entertainment Network=4sims, Media Segment for Sub-Indexed Media Segment format=5sisx, Single Index Segment forindex MPEG-2 TS=6ssss, Subsegment Index Segment used to index MPEG-2 Segments=7uvvu, UltraViolet file brand for DECE Common Format =TABLGTA in-game text (GXT),x version %d, used in GTA SA/IV =IRED1REDCode Video =!PKMozilla archive omni.jaapplication/x-zipja =:BSGBSN archive data =1LILOLinux/i386 LILO boot/chain loader =EYWRAmigaWriter file =9BSGBSN archive data ={NCCHNintendo 3DS=|File Archive (CFA)=}Executable Image (CXI)>P~: "%.16s"=magic/consolex (Old3DS System Update v=.nintendo-3ds-version-codemagic/consolex )=magic/consolex (New3DS System Update v=.nintendo-3ds-version-codemagic/consolex )!magic/console!magic/consolex(v=.nintendo-3ds-version-codemagic/consolex)=(New3DS only) =MOC3Live2D Cubism MOC3=, SDK version invalid/unknown (%d)=, SDK version 3.0.00 - 3.2.07 (%d)=, SDK version 3.3.00 - 3.3.03 (%d)=, SDK version 4.0.00 - 4.1.05 (%d)=, SDK version 4.2.00 - 4.2.02 (%d)=, SDK version 5.0.00 (%d)>, SDK version unknown (%d)=, little endian>, big endianapplication/x-moc3-datamoc3 =CAFFLive2D Cubism archivexversion %dx.%dx.%d=----, standard format!----, unknown format (%.4s)x version %dx.%dx.%d=, no obfuscation!, XOR obfuscation key %dapplication/x-cubism-archivecmo3/can3 =@ۥ-Microsoft WinWord 2.0 Documentapplication/msword =@bnryGTA Item Placement data (IPL), used in GTA SA/IV,x %d items =@VMDKVMware4 disk image =_@RRDRRDTool DBx`@version %s! b16bit aligned=% c/%C+[big-endianxd32bit long (m68k)= fmagic/database! g32bit aligned=% h/%C+[big-endian=i64bit long!j32bit long=& k/%C+[little-endian=l64bit long!m32bit long (i386)= nC+[/%middle-endian!o32bit long (arm)=q64bit aligned=%r/%C+[big-endian=s64bit long (s390x)!t32bit long (hppa/mips/ppc/s390/SPARC)=&u/%C+[little-endian=v64bit long (alpha/amd64/ia64)!w32bit long (armel/mipsel) =@QFIQEMU QCOW Imageapplication/x-qemu-diskx(v%d)> , has backing file (> path %s> , mtime %s)x)x, %lld bytes=$, AES-encrypted=(v2)>, has backing file> (path %s)x , %lld bytes= , AES-encrypted= (v3)>, has backing file> (path %s)x, %lld bytes= , AES-encryptedx(unknown version) =@QEVMQEMU suspend to disk image ="@QEDQEMU QED Image =% @PCO-PCO B16 image datax & , %dxx ' %d= ( , short header= ) , extended header= * , grayscale= $+ linear LUT= $, logarithmic LUTx - [%dx . ,%d]= / , color= @0 linear LUT= @1 logarithmic LUTx (2 r[%dx ,3 ,%d]x 04 g[%dx 45 ,%d]x 86 b[%dx <7 ,%d] = @KXTSKeyman Compiled Keyboard Fileapplication/vnd.keyman.kmxkmxx  version 0x%x& 0 KMX+ Data = @KSSXKSS music file v1.20=!magic/msx="@, 60Hz=#@@, 50Hz=$, soundchips: AY-3-8910, SCC(+)=%, soundchips: SN76489=&stereo=',=(YM2413=)YM2413, Y8950=*YM2413+Y8950 pseudostereo=+, Majyutsushi DAC =@KSCCKSS music file v1.03=magic/msx=, soundchips: AY-3-8910, SCC(+)=, soundchip(s): SN76489=stereo=, YM2413=, Y8950 =@KDMVVMware4 disk image =} @ISc(InstallShield Cabinet archive data=~ `version 6,! `version 4/5,x  ( %u files =@COWDVMWare3=disk imagex (%d/x $%d/x (%d)=undoable disk image> (%s) =@=rlSereal data packetapplication/sereal=.serealmagic/sereal =@=srlSereal data packetapplication/sereal=.serealmagic/sereal =@ Windows metafile=.wmf-headmagic/msdos =Unicode text, UTF-32, little-endian =tOcGit pack index=, version 2 =8BSGBSN archive data =?binMySQL replication log,x @server id %d=Amagic/sql= BE, MySQL V3.2.3xC, server version %s= DK, MySQL V4.0.2-V4.1xE, server version %s=FMySQL V5+,xGserver version %s=HMARIALOGMySQL Maria transaction log filexIVersion %d =JMIT scheme (library?) =PC formatted floppy with no filesystem =I@CMU window manager raster image data> J%d x> K%d,> L%d-bit = ھCytovision FLEX file = Cytovision Karyotype file = Cytovision FLEX file =GNU message catalog (little endian),x revisionapplication/x-gettext-translationgmo/mox %u.x %ux , %u message>  s= &magic/gnu! ', at %#x string table> )magic/gnu! *0, at %#x string tablex $2, %u sysdep message> $3s > Omagic/gnu x Pmagic/gnuxR, %s > Tmagic/gnu x Umagic/gnu!V magic/gnuxW'%s'=Y magic/gnu !Z magic/gnux['%s' =] magic/gnux^'%s' = sfsUnicode text, UTF-8-EBCDIC =Biosig/Walter Graphtek =if Syzygy DTZ tablebaseapplication/syzygy = VCDIFF binary diff = Cytovision Metaphases file =Z jmXpack single archive dataxpa = HRBHarbour HRB filex !version %d =#HBVHarbour variable dump filex $version %d =0VMS VAX executable=PK, Info-ZIP SFX archive v5.12 w/decryption =Biosig/Walter Graphtek = Cytovision RATS file =!Linux-8086 object file =`GNU message catalog (big endian),application/x-gettext-translationgmo/moxmrevision %d.>n%d,xo%d messages,x$p%d sysdep messages=q%d,xr%d messages ={3HFHAP archive data ="EPC archive data =PPMD archive data =JNGJNG video data,video/x-jng!  CORRUPTED,=  magic/animationx%d xx%d =MNGMNG video data,video/x-mng!  CORRUPTED,=  magic/animationx%d xx%d =Virtutech CRAFFxv%d= uncompressed= bzipp2ed= gzipped= not clean =OPSInterleaf saved data = PGP RSA encrypted session key -xkeyid: %08Xx%08X= RSA (Encrypt or Sign) 8192b= RSA Encrypt-Only 8192b =PGP Elgamal encrypted session key -xkeyid: %08Xx%08X= Elgamal Encrypt-Only 3072b. =PGP Elgamal encrypted session key -xkeyid: %08Xx%08X= Elgamal Encrypt-Only 2048b. = PGP RSA encrypted session key -xkeyid: %08Xx%08X= RSA (Encrypt or Sign) 4096b= RSA Encrypt-Only 4096b =PGP RSA encrypted session key -xkeyid: %08Xx%08X= RSA (Encrypt or Sign) 3072b= RSA Encrypt-Only 3072b =PGP Elgamal encrypted session key -xkeyid: %08Xx%08X= Elgamal Encrypt-Only 1024b. ={ PGP RSA encrypted session key -x|keyid: %08Xx}%08X= ~RSA (Encrypt or Sign) 2048b= RSA Encrypt-Only 2048b =verEtherPeek/AiroPeek/OmniPeek capture file =OLFOLF=invalid class=32-bit=64-bit=invalid os=OpenBSD=NetBSD=FreeBSD=4.4BSD=Linux=SVR4=esix=Solaris= Irix= SCO= Dell= NCR=invalid byte order= LSB= !no file type,= "relocatable,= #executable,= $shared object,= 'core file>8(of '%s'> 8)(signal %d),& *processor-specific,= +no machine,= ,AT&T WE32100 - invalid byte order,= -SPARC - invalid byte order,= .Intel i386,= /Motorola 68000 - invalid byte order,= 0Motorola 88000 - invalid byte order,= 1Intel i486,= 2Intel i860,= 3MIPS R3000_BE - invalid byte order,= 4 Amdahl - invalid byte order,= 5 MIPS R3000_LE,= 6 RS6000 - invalid byte order,= 7PA-RISC - invalid byte order,= 8nCUBE,= 9VPP500,= :SPARC32PLUS,= ;PowerPC,= <&Alpha,= =invalid version= >version 1= $?MathCoPro/FPU/MAU Required>@(%s)=AMSB=Bno file type,=Crelocatable,=Dexecutable,=Eshared object,=Fcore file,>8Gof '%s'>8H(signal %d),&Iprocessor-specific,=Jno machine,=KAT&T WE32100,=LSPARC,=MIntel i386 - invalid byte order,=NMotorola 68000,=OMotorola 88000,=PIntel i486 - invalid byte order,=QIntel i860,=RMIPS R3000_BE,=S Amdahl,=T MIPS R3000_LE - invalid byte order,=U RS6000,=VPA-RISC,=WnCUBE,=XVPP500,=YSPARC32PLUS,=ZPowerPC or cisco 4500,=[cisco 7500,=\cisco SVIP,=]cisco 7200,=^$cisco 12000,=_&Alpha,=`invalid version=aversion 1=$bMathCoPro/FPU/MAU Required = xar!xar archiveapplication/x-xarxar/pkg/xip> , header size %u> version %u,x compressed TOC: %llu,= no checksum= SHA-1 checksum= MD5 checksum= SHA-256 checksum= SHA-512 checksum> unknown %#x checksum= magic/archivex magic/archive x magic/archive x magic/archivex) , contains = magic/archivex magic/archive x magic/archive x magic/archivex) , contains = magic/archivex magic/archive x magic/archive x magic/archivex) , contains = magic/archivex> magic/archive x magic/archive x magic/archivex) , contains =wvpkWavPack Lossless Audio = wsdlPHP WSDL cache,x version %#02xx  , created %s< magic/wsdlx , uri: "%s"< magic/wsdlx , source: "%s"< magic/wsdlx , target_ns: "%s" =wdexAndroid vdex file, being processed by dex2oat,>000verifier deps version: %s,>000dex section version: %s,> number of dex files: %d,> verifier deps size: %d =wOFFWeb Open Font Formatfont/woff=.woffmagic/fontsx, version %dx.%d =wOF2Web Open Font Format (Version 2)font/woff2woff2=.woffmagic/fontsx, version %dx.%d =vdexAndroid vdex file,>000verifier deps version: %s,>000dex section version: %s,> number of dex files: %d,> verifier deps size: %d =tfMRMS Windows help Full Text Search indexapplication/x-winhelp-ftsfts>for "%s" =sSquish archive data =sqshSquashfs filesystem, big endian,=.squashfsmagic/filesystems =specSPEC= .cpuCPU< :%.4s= .raw result text =sTaCLZS221 archive data =regfMS Windows registry file, NT/2000 or above =(rdqxReDuq archive data =kq#]Syzygy WDL tablebaseapplication/syzygy =^qoifQOI image dataimage/x-qoiqoixb%uxxc%u,= ds= eRGB= fRGBAx gmagic/imagesx h*bad channels %u*= i(linear alpha)= jmagic/images= kRGB= lRGBA= m(all channels linear)x nmagic/imagesx o*bad colorspace %u* =qktkApple QuickTake 100 Raw Image= .quicktakemagic/images =@pst0perl Storable (v0.7) data>Amagic/perl&B(network-ordered)=C(major 2)=D(major 2)>E(minor %d) =ply PLY model,ply= format ascii ASCII,=[0-9.]+version %s= format binarybinary,=_little_endian little endian,=[0-9.]+version %s= _big_endian big endian,=[0-9.]+version %s = pQ9PAQ9A archive =pM86Atari ST STAD bitmap image data (vert)=(white background)=(black background) =pM85Atari ST STAD bitmap image data (hor)=(white background)=(black background) =naUzxo65 library,x version %d =mdbmmdbm file,xversion %d,x2^%d pages,xpagesize 2^%d,xhash %d,x dataformat %d =llvmLLVM byte-codes, uncompressed =lectDEC SRC Virtual Paper Lectern file =kychMac OS X Keychain File =( icnsMac OS X iconimage/x-icns????icnsicns>, magic/imagesx. , %d bytesx0 , "%4.4s" type =hsqsSquashfs filesystem, little endian,= .^squashfsmagic/filesystems =nhsi1JPEG image data, HSI proprietaryimage/x-hsihsi/jpg =gpchGCC precompiled headerx (version %cx %cx %c)=Cfor C=ofor Objective-C=+for C++=Ofor Objective-C++ =gmonGNU prof performance datax- version %d =rglTFglTF binary modelx s, version %dx t, length %d bytesmodel/gltf-binaryglb =gfMRMS Windows help Full Text search Groupapplication/x-winhelp-ftgftg>for "%s" =mgWARQ archive data =fLaCFLAC audio bitstream dataaudio/flac>, unknown version=magic/audio=0, 4 bit=P, 6 bit=p, 8 bit=, 12 bit=, 16 bit=p, 24 bit=, mono=, stereo=, 3 channels=, 4 channels=, 5 channels= , 6 channels= , 7 channels=, 8 channels=, 11.025 kHz=, 16 kHz= b, 22.05 kHz=, 24 kHz=, 32 kHz=@ , 44.1 kHz=  , 48 kHz= , 64 kHz= , 88.2 kHz= p, 96 kHz= @, 128 kHz=+, 176.4 kHz=., 192 kHz=>, 256 kHz="V, 352.8 kHz=], 384 kHz>, >4G samples=magic/audio>, %u samples=, length unknown = fSqueak image data ='drpmDelta RPMapplication/x-rpmx )%s=* MIPSel=+ ARM=, MiNT=-S/390=.S/390x=/PowerPC64=0SuperH=1Xtensa=2AArch64=3MIPSr6=4MIPS64r6=5RISC-V64=6LoongArch64x 7%s =. dlV2NeXT version 3 disklabel=. / nextmagic/filesystems =, dlV1NeXT version 2 disklabel=. - nextmagic/filesystems =corecore file (Xenix) =caffCoreAudio Format audio file< version %d =bvxnlzfse encoded, lzvn compressed =bvx2lzfse compressed, compressed tables =bvx1lzfse compressed, uncompressed tables =bvx-lzfse encoded, no compression =bmBirtual Machinex , version %dx , program size %ux  , memory size %ux  , memory capacity %u =bFLTBFLT executablex - version %d= magic/bflt=$ ram=$ gotpic=$ gzip=$gzdata ="axgxBiosig/AXGbiosig/axg =4a\WinHKI archive data =\1cwChiWriter file =ZXSTzx-state snapshotxversion %dx.%d=16k ZX Spectrum=48k ZX Spectrum/ZX Spectrum+=ZX Spectrum 128=ZX Spectrum +2=ZX Spectrum +2A/+2B=ZX Spectrum +3=ZX Spectrum +3e=Pentagon 128=Timex Sinclair TC2048= Timex Sinclair TC2068= Scorpion ZS-256= ZX Spectrum SE= Timex Sinclair TS2068= Pentagon 512=Pentagon 1024=48k ZX Spectrum (NTSC)=ZX Spectrum 12Ke=(alternate timings) =-ZEC3Zope Object Database Client Cache File (data) =XhDrX1 archive data = XcurXcursor dataimage/x-xcursorx "version %dx #.%d = XcurX11 cursor =hXTF0XTF, Microsoft Xbox data =XPR0Microsoft Xbox XPR0 texturex, format:=.xbox-xpr-pixel-formatmagic/images =XPKFAmiga xpkf.library compressed data = XPDSDPX image data, little-endian,image/x-dpx= . ^dpx_infomagic/images =gXIP0XIP, Microsoft Xbox data =XEX2Microsoft Xbox 360 executableaudio/x-xbox360-executablexex=magic/console=.xbox-360-xex-execution-idmagic/console=.xxbox-360-xex-region-codemagic/console =XEX1Microsoft Xbox 360 executable (XEX1)audio/x-xbox360-executablexex=magic/console=.xbox-360-xex-execution-idmagic/console=.Txbox-360-xex-region-codemagic/console =EXCPNetXRay capture file>F- version %s= ,G(Ethernet)= ,H(Token Ring)= ,I(FDDI)= ,J(WAN)= ,K(ATM)= ,L (802.11) =LXBEHMicrosoft Xbox executableaudio/x-xbox-executablexbe= Pmagic/consolex Q: "%.40s"x R(%cx S%c-x T%03u)= `U, all regions ! `Vmagic/console > `W(regions: & `XNA & `YJapan & `ZRest_of_World & `[Manufacturer> `\)= ^magic/console = _magic/console= `, not signed> amagic/console > bmagic/console> c, signed =XALZXamarin LZ4-compressed assemblyx , uncompressed size %u =ZXAD!eXotic ADlib =(X psSoftQuad troff Context intermediate for PostScript =&X hpSoftQuad troff Context intermediate for HP LaserJet =WIANintendo=HGameCubeapplication/x-gamecube-rom=HWiiapplication/x-wii-romxHGameCube/WiixHdisc image (WIA format):=.Xnintendo-gcn-disc-commonmagic/console =VTF3Valve Texture Format (PS3)x, %ux x %u= , DXT1= , DXT5 =VTFValve Texture Formatx v%ux .%ux , %u> x %u=magic/images> ?x %u> , %u framesx8, mipmaps: %u> 4,=.4vtf-image-formatmagic/images =VMAPNational Instruments, VXI File, data =VER2GTA archive (IMG), version 2, used in GTA SA,x %d items =VBOXVBOX voice message data =Uznaxo65 object,x  version %d,=  with debug info=  no debug info =UUBiosig/Walter Graphtekbiosig/walter-graphtek =UTE+uterus file=v, versionx %c= ..x %c= <>, big-endian> , slut size %u=><, little-endian> , slut size %u& , compressed =:UPS1UPS patch fileups =UN05MikMod UNI format module sound data = UF2 UF2 firmware imageuf2& , not main flash& , file container&  , family= iST STM32L4xx=  $ST STM32L5xx= { ST STM32F411xC=  JxM0SENSE BL702= !6WMicrochip (Atmel) ATmega32= " xQMicrochip (Atmel) SAML21= #_tWNordic NRF52= $!_ESP32= %-CST STM32L1xx= &:. ST STM32L0xx= 'F!ST STM32WLxx= ("Realtek AmebaZ RTL8710B= )w*NXP LPC55xx= *҈+ESP32-C2= + -ST STM32F411xE= ,3V0ST STM32G0xx= -(1GD32F350= .&'3ESP32-H2= /y3Realtek AmebaD RTL8720D= 00=ESP32-P4= 1qMhKSipeed MaixPlay-U4 (BL618)= 2 $qLST STM32G4xx= 3RjOLISTENAI CSK300x/400x= 4ղONXP i.MX RT10XX= 5QXradiotech 809= 6SST STM32F7xx= 7b TESP32-C6= 8`DUMicrochip (Atmel) SAMD51= 9WZuWST STM32F4xx= :ZCypress FX2= ;. ]ST STM32F2xx= <r^ST STM32F103= =zbNordic NRF52833= >$xdST STM32F0xx= ?@ZgBeken 7231U/7231T= @+hMicrochip (Atmel) SAMD21= AbiWCH CH32V2xx and CH32V3xx= BB̂jBeken 7251/7252= CakST STM32F3xx= D" mST STM32F407= E`mST STM32H7xx= FHsnLISTENAI CSK60xx= Gx&uoNordic NRF52832xxAB= HSfpST STM32WBxx= INrrNordic NRF52832xxAA= JPwESP32-C61= K0>{Beken 7231N= Lm{Renesas RA4M1= Ma~ESP8266= NNXP KL32L2x= O`ST STM32F407VG= P/BRenesas RZ/A1LU (R7S7210xx)= Q3>GigaDevice GD32VF103= RCRealtek Ameba1 RTL8710A= S{ɠArteryTek AT32F415= T@(Nordic NRF52840= UNݿESP32-S2= VgW~ESP32-S3= Wl+ESP32-C3= XpBoufallo 602= YduRealtek AmebaZ2 RTL8720C= ZVRaspberry Pi RP2040= [WRaspberry Pi MC: Absolute (unpartitioned) download= \XRaspberry Pi MC: Data partition download= ]YRaspberry Pi RP2350, Secure Arm image= ^ZRaspberry Pi RP2350, RISC-V image= _[Raspberry Pi RP2350, Non-secure Arm image= `CESP32-C5xcmagic/uf2x d%#08x= e , file sizex f%#08x& g@, MD5 checksum present& h, extension tags presentx i, base address %#08xx j, %u total blocks =UC2UC2 archive data =TZiftimezone data =3 TZif(slim)=.3!timezonemagic/timezonex3"(fat)=.#timezonemagic/timezone =TTA1True Audio Lossless Audio = TPH2Turbo Pascal help, version 2application/x-pascal-hlphlp =fTNESNES ROM image (Nintendo 3DS Virtual Console)application/x-nes-rom=hd: FDS,=. inintendo-fds-disk-info-blockmagic/console!jd: TNES mapper %uxk, %ux8k PRGxl, %ux8k CHR=m[WRAM]=n [H-mirror]=o [V-mirror]=p[VRAM] =TKEYGTA in-game text (GXT), version 2, used in GTA III =kTHPNintendo THP Multimedia =TBISAMtools TBI (Tabix index format)= , with %d reference sequence> , with %d reference sequences& , using half-closed-half-open coordinates (BED style)^ magic/bioinformatics= , using closed and one based coordinates (GFF style)= , using SAM format= , using VCF formatx , sequence name column: %dx , region start column: %d=  magic/bioinformaticsx !, region end column: %dx", comment character: %cx #, skip line count: %d =TABLGTA in-game text (GXT), version 3, used in GTA VC/LS/VCS =T707Roland TR-707 Data =SymMSymphonie SymMOD music file =oSnApLVM Snapshot (CopyOnWrite store)! p- valid,= q- invalid,x rversion %d,x schunk_size %d =Sfffstructured fax file =CSZ SZip archive data =SQSHsquished archive data (Acorn RISCOS) =SONGDigiTrekker DTM Module =SMVSNES9x input recordingx , version %d< magic/consolex , recorded at %s> , rerecorded %d timesx , %d frames long>, data for controller(s):&#1&#2&#3&#4&#5^, begins from snapshot&, begins from reset^, NTSC standard&, PAL standard&, settings:< magic/console&WIP1Timing&Left+Right&VolumeEnvX&FakeMute& SyncSound> magic/console&NoCPUShutdown< magic/console> #magic/console! magic/consolex , metadata: "%s"> magic/console>$, port 1:=$joypad=$mouse=$SuperScope=$Justifier=$multitap>$, port 2:=%joypad=%mouse=%SuperScope=%Justifier=%multitap> Cmagic/console! @magic/consolex@, metadata: "%s"&@, ROM:x CRC32 %#08xx "%s" =SMODFuture Composer 1.3 Module sound file =SMDHNintendo 3DS SMDH file! magic/consolex: "%.128s"! magic/consolexby %.128s= magic/console! magic/consolex: "%.128s"! magic/consolexby %.128s =SMD1SymbOS driverx, name: %cx%cx%cx%cx%cx%cx%cx%cx%cx%cx%cx%cx%c =SLIBSoftlib archivex , version %dx (contains %d files) =3SITDStuffIt Deluxe (data)x4: %s =/SIT!StuffIt Archive (data)application/x-stuffitSIT!SIT!x2: %s =SGA3StarOffice Gallery thumbnailsapplication/x-stargallery-sdgsdg = SDPXDPX image data, big-endian,image/x-dpx=. dpx_infomagic/images =SChFChArc archive data =SCgfSuperCollider3 Synth Definition file,xversion %d =SCVMScummVM savegame> "%s" =WSAdTSurprise! Adlib TrackerxXVersion %d =RastRST-format raster font data>-0face %s =RZX!Spectrum .RZX dataxversion %dx.%d =uRZIPrzip compressed dataxv- version %dxw.%dxx(%d bytes) =,RVZNintendo=H-GameCubeapplication/x-gamecube-rom=H/Wiiapplication/x-wii-romxH1GameCube/WiixH2disc image (RVZ format):=.X3nintendo-gcn-disc-commonmagic/console = RTSSNetMon capture filex - version %dx.%d= (Unknown)= (Ethernet)= (Token Ring)= (FDDI)= (ATM)> (type %d) =RTMMRTM Module =gRSTMNintendo Wii BRSTM audio fileaudio/x-brstmbrstm=kmagic/audio=.lnintendo-wii-brstm-fieldsmagic/audio= mmagic/audio=.n^nintendo-wii-brstm-fieldsmagic/audio = RSRCNational Instruments,=LVLabVIEW File,= SBCode Resource File, data= INVirtual Instrument Program, data= ARVI Library, data=LMNULBVWPortable File Names, data=rscResources File, data = RSIDRSID sidtune PlaySID compatible> w/ header v%d,= single song,> %d songs,>default song: %d>name: "%s">6author: "%s">Vcopyright: "%s" =BRMD1raw modem data>C(%s />Dcompression type %#04x) =VRIX7ColoRIX Slideshow =SRIX3ColoRIX Image= .Trix-headermagic/images =IRIFXRIFF (big-endian) data=KPAL, palettexL, version %dxM, %d entries=ORDIB, device-independent bitmap=PBMmagic/riff=Q , OS/2 1.x formatx"R, %d xx$S%d=T@, OS/2 2.x formatx"U, %d xx$V%d=W(, Windows 3.x formatx"X, %d xx&Y%d xx,Z%d=\RMID, MIDI=^RMMP, multimedia movie=`WAVE, WAVE audio= a, Microsoft PCM> "b, %d bit=c, mono=d, stereo>e, %d channels>f%d Hz=jCDRmagic/riff= .k^corel-drawmagic/riff=nAVI , AVI=pACON, animated cursor=rNIFF, Notation Interchange File Format=tsfbkSoundFont/Bank =RIFFRIFF (little-endian) data=PAL , paletteapplication/x-riffpalx , %u bytes= plth, extended= datamagic/riffx , data size %ux , %u entries x magic/riffx , extra bytes> %#8.8x= RDIB, device-independent bitmaprdi/dib=BMmagic/riff=  , OS/2 1.x formatx ", %d xx $%d= @, OS/2 2.x formatx ", %d xx $%d= (, Windows 3.x formatx ", %d xx &%d xx ,%d=RMID, MIDIaudio/midrmi=#RMMP, multimedia movievideo/x-mmmmmm='RMP3, MPEG Layer 3 audio=+WAVE, WAVE audioaudio/x-wavwav/wave> 1magic/riff= . 2riff-walkmagic/riff= 4magic/riff= 5magic/riff=6magic/riff=.7tr500-call-recorder-headermagic/riff=:cdrmagic/riff!<CDRXcontmagic/riff= .>corel-drawmagic/riff=ACDRXcont, Corel Clipartapplication/x-corel-ccxccxx F, %u bytes=KCDTmagic/riff= .Lcorel-drawmagic/riff=NCDSTmagic/riff= .Ocorel-drawmagic/riff=QPATmagic/riff= .Rcorel-drawmagic/riff=VDESmagic/riff!WDESCmagic/riff= .Xcorel-desmagic/riff=ZDESCmagic/riff=cshw4, CorelSHOW presentation, version 4application/x-corel-shwshw=ishw5, CorelSHOW presentation, version 5application/x-corel-shwshw=oshl5, CorelSHOW Background, version 5application/x-corel-shbshb=vshr5, CorelSHOW player data, version 5application/x-corel-shrshr={NUNDROOT, Steinberg CuBase=IDF LIST, MIDI Instrument Definition Fileaudio/x-idfidfx0"%s"=1instbyx$"%s"=MDLmagic/riff= MDLH, Microsoft Flight Simulator 3D modelapplication/x-ms-mdlmdl=AVI , AVIvideo/x-msvideoavi/divx= LISTmagic/riff=hdrlavihmagic/riffx $, %u xx (%u,> @B<1 fps,= @B1.00 fps,=  2.00 fps,= 3.00 fps,= 4.00 fps,= @ 5.00 fps,=  6.00 fps,=  .7.00 fps,= H8.00 fps,= 9.00 fps,= 10.00 fps,< magic/riff> ‚magic/riff! ~10 fps,= E12.00 fps,< BHmagic/riff> Bmagic/riff! E~12 fps,= k15.00 fps,< *magic/riff> magic/riff! k~15 fps,= P20.00 fps,= 23.98 fps,= â24.00 fps,< qmagic/riff> magic/riff! magic/riff! â~24 fps,= @25.00 fps,< magic/riff> magic/riff! @~25 fps,= W29.97 fps,= 530.00 fps,< magic/riff> ǁmagic/riff! Wmagic/riff! 5~30 fps,< }>30 fps,=XLISTmagic/riff=`strlstrhmagic/riff=lvidsvideo:= uncompressed= hlstrfmagic/riff= hRLE 8bpp= hanimIntel RDX= haur2AuraVision Aura 2= hauraAuraVision Aura= hbt20Brooktree MediaStream= hbtcvBrooktree Composite Video= hcc12Intel YUV12= hcdvcCanopus DV= hchamWinnov Caviara Cham= hcljrProprietary YUV 4 pixels= hcmykCommon Data Format in Printing= hcplaWeitek 4:2:0 YUV Planar= hcvidCinepak= hcwltMicrosoft Color WLT DIB= hcyuvCreative Labs YUV= hd261H.261= hd263H.263= hduckTrueMotion 1.0= hdve2DVE-2 Videoconferencing= hfljpField Encoded Motion JPEG= hfvf1Fractal Video Frame= hgwltMicrosoft Greyscale WLT DIB= hh260H.260= hh261H.261= hh262H.262= hh263H.263= hh264H.264= hh265H.265= hh266H.266= hh267H.267= hh268H.268= hh269H.269= hi263Intel I.263= hi420Intel Indeo 4= hianIntel RDX= hiclbCellB Videoconferencing Codec= hilvcIntel Layered Video= hilvrITU-T H.263+= hirawIntel YUV Uncompressed= h iv30Intel Indeo 3= h iv31Intel Indeo 3.1= h iv32Intel Indeo 3.2= h iv33Intel Indeo 3.3= h iv34Intel Indeo 3.4= hiv35Intel Indeo 3.5= hiv36Intel Indeo 3.6= hiv37Intel Indeo 3.7= hiv38Intel Indeo 3.8= hiv39Intel Indeo 3.9= hiv40Intel Indeo 4.0= hiv41Intel Indeo 4.1= hiv42Intel Indeo 4.2= hiv43Intel Indeo 4.3= hiv44Intel Indeo 4.4= hiv45Intel Indeo 4.5= hiv46Intel Indeo 4.6= hiv47Intel Indeo 4.7= hiv48Intel Indeo 4.8= hiv49Intel Indeo 4.9= hiv50Intel Indeo 5.0= hmpegMPEG 1 Video Frame= hmjpgMotion JPEG= h mp42Microsoft MPEG-4 v2= h!mp43Microsoft MPEG-4 v3= h"mrcaMR Codec= h#mrleRun Length Encoding= h$msvcMicrosoft Video 1= h%phmoPhotomotion= h&qpeqQPEG 1.1 Format Video= h'rgbtRGBT= h(rle4Run Length Encoded 4= h)rle8Run Length Encoded 8= h*rt21Intel Indeo 2.1= h+rvxIntel RDX= h,sdccSun Digital Camera Codec= h-sfmcCrystal Net SFM Codec= h.smscSMSC= h/smsdSMSD= h0splcSplash Studios ACM Audio Codec= h1sqz2Microsoft VXtreme Video Codec= h2sv10Sorenson Video R1= h3tlmsTeraLogic Motion Intraframe Codec A= h4tlstTeraLogic Motion Intraframe Codec B= h5tm20TrueMotion 2.0= h6tmicTeraLogic Motion Intraframe Codec 2= h7tmotTrueMotion Video Compression= h8tr20TrueMotion RT 2.0= h9ultiUltimotion= h:uyvyUYVY 4:2:2 byte ordering= h;v42224-bit YUV 4:2:2 format= h<v65516-bit YUV 4:2:2 format= h=vcr1ATI VCR 1.0= h>vcr2ATI VCR 2.0= h?vcr3ATI VCR 3.0= h@vcr4ATI VCR 4.0= hAvcr5ATI VCR 5.0= hBvcr6ATI VCR 6.0= hCvcr7ATI VCR 7.0= hDvcr8ATI VCR 8.0= hEvcr9ATI VCR 9.0= hFvdctVideo Maker Pro DIB= hGvidsYUV 4:2:2 CCIR 601 for V422= hHvivoVivo H.263= hIvixlVIXL= hJvlv1VLCAP.DRV= hKwbvcW9960= hLx263mmioFOURCC('X','2','6','3')= hMxlv0XL Video Decoder= hNy211YUV 2:1:1 Packed= hOy411YUV 4:1:1 Packed= hPy41bYUV 4:1:1 Planar= hQy41pPC1 4:1:1= hRy41tPC1 4:1:1 with transparency= hSy42bYUV 4:2:2 Planar= hTy42tPC1 4:2:2 with transparency= hUyc12Intel YUV12 Codec= hVyuv8Winnov Caviar YUV8= hWyuv9YUV9= hXyuy2YUY2 4:2:2 byte ordering packed= hYyuyvBI_YUYV, Canopus= hZfmp4FFMpeg MPEG-4= h[div3DivX 3=p\div3Low-Motion=p]div4Fast-Motion= h^divxDivX 4= h_dx50DivX 5= h`xvidXviD= hah264H.264= hbwmv3Windows Media Video 9= hch264X.264 or H.264= hdmagic/riff= \`gLISTmagic/riff= \hhstrlstrhmagic/riff= \tiauds, audio:= \kstrfmagic/riff= \luncompressed PCM= \mADPCM= \naLaw= \ouLaw= \pPMPEG-1 Layer 1 or 2= \qUMPEG-1 Layer 3= \r Dolby AC3= \saDivX= \u(mono,= \v(stereo,> \w(%d channels,x \x%d Hz)= \zstrfmagic/riff= \{uncompressed PCM= \|ADPCM= \}UMPEG-1 Layer 3= \~ Dolby AC3= \aDivX= \(mono,= \(stereo,> \(%d channels,x \%d Hz)=VDRM, VirtualDub linkvideo/x-vdrvdr= PATH, PATHx %s=ACON, animated cursorapplication/x-navi-animationani=INAMmagic/riffx "%s" =  TRAImagic/riffx %s=sfbk, SoundFont/Bankaudio/x-sfbksf2=CDXA, wrapped MPEG-1 (CDXA)video/x-cdxampg/dat=4XMV, 4X Movie filevideo/x-4xmv4xm/4xa=AMV , AMVvideo/x-amvamv=WEBP, Web/P imageimage/webpwebp= . riff-walkmagic/riff=MIDS, MIDI Streamaudio/x-midsmds=TRID, TrID defs packageapplication/x-trid-trdtrd=imag, Easy CD Creator disk imageapplication/x-corel-cifcif=CD001; with=.cdrommagic/riff =RGDBCRDA wireless regulatory database file=(Version 1) =RE~^RAR archive data (p(V.%1.1s) =PWS3Password Safe V3 database =PWADdoom patch PWAD datax containing %d lumps =)PVRPowerVR 3.0 texture:x *%u xx +%u> ,x %ux-,= .magic/images=./pvr3-pixel-formatmagic/images! 0magic/images!1%c! 2%u! 3%c! 4%u! 5%c!6%u! 7%c!8%u= 9, sRGB= :, premultiplied alpha =PSMProtracker Studio PSM Module =PSIDPlaySID v2.2+ (AMIGA) sidtune>w/ header v%d,=single song,>%d songs,>default song: %d>name: "%s">6author: "%s">Vcopyright: "%s" =@PSARSony PlayStation ArchivepsarcxB, version %d.xC%d=Dzlib, zlib compression=Elzma, LZMA compression=F, relative paths=G, absolute paths=H, ignore case =KPPMZPPMZ archive data =PP20Power Packer 2.0 compressed data,= fast compression= mediocre compression= good compression= very good compression= best compression =PP11Power Packer 1.1 compressed data =PMCCWindows 3.x .GRP file =PMCCMS Windows 3.1 group files =jPLEXBiosig/Plexon v1.0 =PKReSOF archive data =PFS0Nintendo Switch partition filesystem (PFS0)x , %d files =PFR1Portable Font Resource font data (new)>f0: %s =PFR0Portable Font Resource font data (old)>version %d =PDS_PDS image data = PDN3Paint.NET image dataimage/x-paintnet =?PDCPDCurses screen image = PAR2Parity Archive Volume Set =PAR1Apache Parquet = PARPARity archive data= 0 - Index file> 0 - file number %d =Ora ELI 5750 archive data =OggSOgg data!UNKNOWN REVISION %u=magic/vorbis=FLAC, FLAC audioaudio/ogg="theora, Theora videovideo/ogg= %kate, Kate (Karaoke and Text)application/oggx%'v%ux&(.%u,=()utf8 encoding,!(*unknown character encoding,><+language %s,=<,no language set,>L-category %s=L.no category set=0fishead, Skeletonvideo/oggx $2v%ux (3.%u=5Speex , Speex audioaudio/ogg= 8video, OGM videovideo/ogg=%:div3(DivX 3)=%;divx(DivX 4)=%<dx50(DivX 5)=%=xvid(XviD)=?vorbis, Vorbis audio,audio/ogg! #AUNKNOWN VERSION %u,= #Cmagic/vorbis='Dmono,='Estereo,>'F%u channels,x (G%u Hz< 0I,! 4Kmagic/vorbis! 4Omagic/vorbis! 4Pmagic/vorbisx 4Q<%u! 0Rmagic/vorbisx 0S~%u! ,Tmagic/vorbis! ,Umagic/vorbis! ,Vmagic/vorbisx ,W>%u< 0Xbps=TU`vorbismagic/vorbis=T`aXiphophorus libVorbis I, created by: Xiphophorus libVorbis I>Txb00000000magic/vorbis<Txd20000508(Txf20000508magic/vorbis<Txg20001031(beta2-3)=Txh20001031(1.0 beta 3)>Txi20001031magic/vorbis<Txj20010225(beta3-4)=Txk20010225(1.0 beta 4)>Txl20010225magic/vorbis<Txm20010615(beta4-RC1)=Txn20010615(1.0 RC1)=Txo20010813(1.0 RC2)=Txp20010816(RC2 - Garf tuned v1)=Txq20011014(RC2 - Garf tuned v2)=Txr20011217(1.0 RC3)=Txs20011231(1.0 RC3)>Txu20011231(pre-1.0 CVS)=T`wXiph.Org libVorbis I, created by: Xiph.Org libVorbis I>Tux00000000magic/vorbis<Tuy20020717(pre-1.0 CVS)=Tuz20020717(1.0)=Tu{20030909(1.0.1)=Tu|20040629(1.1.0 RC1)=Tu}20050304(1.1.2)=Tu~20070622(1.2.0)=Tu20090624(1.2.2)=Tu20090709(1.2.3)=Tu20100325(1.3.1)=Tu20101101(1.3.2)=Tu20120203(1.3.3)=Tu20140122(1.3.4)=Tu20150105(1.3.5)=OpusHead, Opus audio,audio/ogg>$UNKNOWN VERSION %u,!$version 0.%u,>.magic/vorbis!.unknown channel mapping family %u,x%%u channels=.magic/vorbis=%mono=%stereo=.magic/vorbis=%mono=%stereo=%linear surround=%quadraphonic=%5.0 surround=%5.1 surround=%6.1 surround=%7.1 surround! (, %u Hz (Input Sample Rate) =COZÝZET archive data =OTTOOpenType font dataapplication/vnd.ms-opentype =4OOOMUser-Mode-Linux's Copy-On-Write disk imagex5version %d =NetSNetStumbler log filex , %d stations found =* NeXTNeXT version 1 disklabel=. + nextmagic/filesystems =DNSVfNullsoft Video =NSO0Nintendo Switch executable (NSO) =RNSFEExtended NES Sound File=0Sauthmagic/audio>T("%s">Uby %s>V, copyright %s>W, ripped by %sxX), %d tracks,=Ydual PAL/NTSC=Zmagic/audio=[PAL=\NTSC =NPFFNItpicker Flow FilexV%d.x%dx  started: %sx stopped: %sx Bytes: %ux Bytes1: %ux Flows: %uxPkts: %u =NITFNational Imagery Transmission Format>dated %.14s =gNEX1Biosig/NEXbiosig/nex1 =1NESNES ROM image (iNES)application/x-nes-rom=.3nes-rom-image-inesmagic/console =NEKONekoVM bytecodex  (%d global symbols,x  %d global fields,x %d bytecode ops)application/x-nekovm-bytecode =VMThdStandard MIDI dataaudio/midixX(format %d)x Yusing %d track> Zsx [at 1/%d> \SMPTE = MTZ MTZ reflection file =8MTSMMinetest Schematicmtsx:, version %dx;, size [%dx<, %dx =, %d] =MT20MadTracker 2.0 Module MT2 = MPQMoPaQ (MPQ) archive =MPCKMusepack audio (MPCK)audio/x-musepack =AMP3MP3-Archiver archive data = MOVISilicon Graphics movie filevideo/x-sgi-movie = MMOROlympus ORF raw image data, big-endianimage/x-olympus-orf =MMMDYamaha SMAF file =MMD3OctaMED Soundstudio music file, version 3 =MMD1OctaMED Pro music file, version 1 =MMD0MED music file, version 0 =MM+Big TIFF image data, big-endianimage/tiff =}MDmdMDCD archive data =qMDMPMini DuMP crash reportapplication/x-dmpdmp/mdmp! w, version %#4.4xx y, %d streams! { , %#8.8x RVA! }, CheckSum %#8.8xx , %sx , %#x type =,MAC Monkey's Audio compressed formataudio/x-ape> .version %d = /with fast compression = 0with normal compression = 1 with high compression = 2with extra high compression = 3with insane compression= 4, mono= 5, stereox 6, sample rate %d< 7version %d= 8with fast compression= 9with normal compression= : with high compression= ;with extra high compression= <with insane compression= =, mono= >, stereox ?, sample rate %d =LinSMicrosoft Paint image data (version 2.0)x (%dx x %d) =LZIPlzip compressed dataapplication/x-lziplzx, version: %d =LYNXLynx cartridgeapplication/x-atari-lynx-romlnx> , bank 0 %dk> , bank 1 %dk> , "%.32s">*, "%.16s">:, rotation %u =#LRZILRZIP compressed dataapplication/x-lrzipx%- version %dx&.%d=', encrypted =LIMLIM archive data =LCDiDream Animator file =LASFLIDAR point data records>, version %u>.%u>, SYSID %s>:, Generating Software %s =AKpGrGarmin update! Cdmagic/mapx Dd, version %ux Ed.%u= .Ggarmin-entrymagic/map x  Imagic/map= .Jgarmin-entrymagic/map x  Lmagic/mapx Mmagic/map= .Ngarmin-entrymagic/mapx Pmagic/map= :TGARMIN BITMAP= image/x-garmin-exeexex)Wmagic/mapx:Y= application/x-garmin-rgnrgn=:]KpGrdmagic/mapx)^magic/map=:`PKmagic/mapx)amagic/map =KiSSKISS/GS=colorx%d bitx %d colorsx %d groups= cellx%d bitx %d xx %dx +%dx +%d =KICKKickstart disk =KEB Knudsen seismic KEL binary (KEB) -= [-A-Z0-9]+Software: %s= V[0-9]+\.[0-9]+version %s =}JAMJAM message area header file> ~(%d messages) =IsZ!ISO Zipped filex, header size %ux, version %ux  , serial %u> , password protected =IWADdoom main IWAD datax containing %d lumps =IT02FIT image datax, %d xx%d xx %d =IT01FIT image datax, %d xx%d xx %d =ISc(InstallShieldapplication/x-installshield! setup headerhdr= CABcabx , version %#x! , volume_info %#x! , offset %#x! , descriptor size %#x =:ISPLispellx;hash file version %d,x<lexletters %d,x =lexsize %d,x>hashsize %d,x?stblsize %d =vIMPSImpulse Tracker Sample&w16 bit^x8 bit&ystereo^zmono =hIMPMImpulse Tracker module sound data -audio/x-mod>j"%s"! (kcompatible w/ITv%x! *lcreated w/ITv%x ={IMPIImpulse Tracker Instrument! |ITv%x!}%d samples =IMP IMP archive data =ILDAILDA Image Data Transfer Format=3D Coordinates with Indexed Color=2D Coordinates with Indexed Color=Color Palette=3D Coordinates with True Color=2D Coordinates with True Color>0, palette %s>0, company %s>, number of records %dx, palette number %d>, number of frames %d>, projector number %d = IIRSOlympus ORF raw image data, little-endianimage/x-olympus-orf = IIROOlympus ORF raw image data, little-endianimage/x-olympus-orf =IIN1NIFF image dataimage/x-niff =II+Big TIFF image data, little-endianimage/tiff =WIGORBiosig/IgorPro ITX filebiosig/igorpro =IDS2Quake II SP2 sprite file =IDP2Quake II 3D Model file,x %u skin(s),x (%u xx %u),x( %u frame(s),x Frame size %u bytes,x%u vertices/frame,x%u texture coordinates,x %u triangles/frame =2IDA2IDA (Interactive Disassembler) database =1IDA1IDA (Interactive Disassembler) database =0IDA0IDA (Interactive Disassembler) database =ID;PMicrosoft SYLK program>0, created by %sslk/sylk =IBSPQuake=&II Map file (BSP)=.III Map file (BSP) =IBKIBK instrument data =HPHPHP=4848 binary=4949 binary>@- Rev %c= )(ADR)= 3)(REAL)= U)(LREAL)= w)(COMPLX)= )(LCOMPLX)= )(CHAR)= )(ARRAY)=  *(LNKARRAY)= ,*(STRING)= N*(HXS)= t*(LIST)= *(DIR)= *(ALG)= *(UNIT)= *(TAGGED)= +(GROB)= @+(LIB)= b+(BACKUP)= +(LIBDATA)= -(PROG)= -(CODE)= H.(GNAME)= m.(LNAME)= .(XLIB) =yHPAKHPack archive data =HPAKHPACK archive data =HM3WWarcraft III map file = HG10Mercurial changeset bundle= UN(uncompressed)= GZ(gzip compressed)= BZ(bzip2 compressed) =HG10Mercurial bundle,=UNuncompressed= BZbzip2 compressed =vHDCSCaris multibeam sonar related data =8GlulGlulx game datax9(Version %dx:.%dx;.%d)=$<InfoCompiled by Informapplication/x-glulx = GVRTSega GVR image:=. sega-gvr-image-headermagic/images =:GTS5GoatTracker 2 song>;, "%s">$< by %s>D= (C) %s>d>, %u subsong(s) =GST2Godot 4 textureimage/x-godot-stexstexx v%u:x (%u xx *%u=. godot-rescale-display-wmagic/images=. !godot-rescale-display-hmagic/imagesx ",> ,#%u mipmaps,=.0$godot-pixel-format-v4magic/images= $%, embedded PNG image= $&, embedded WebP image= $', Basis Universal =GMBUNetMon capture filex- version %dx.%d= (Unknown)= (Ethernet)= (Token Ring)= (FDDI)=  (ATM)= !(IP-over-IEEE 1394)= "(802.11)= #(Raw IP)= $(Raw IP)= % (Raw IP)> & (type %d) =GKSMGKS Metafile=SunGKS, SunGKS =GDSTGodot 3 texture:image/x-godot-stexstexx %u xx %u= ,!  magic/images=. godot-rescale-display-wmagic/images=. godot-rescale-display-hmagic/imagesx ,!  has mipmaps,= lossless encoding=  lossy encoding= 0magic/images=.godot-pixel-format-v3magic/images =GDBMGNU dbm 2.x databaseapplication/x-gdbm =*GCAXGCA archive data =GBSTGTA2/GBH style data (STY), in-game graphics,x version %d =GBSNintendo Gameboy Music/Audio Dataaudio/x-nintendo-gbsgbs>("%.32s" by>0%.32s, copyright>P %.32sx ), %u track>s!, %u firstx , load address %#4.4xx , init address %#4.4xx , play address %#4.4xx , stack pointer %#4.4x!, timer modulo %#x!, timer control %#x =GBMPGTA2/GBH map layout (GMP),x version %d =FTMNFaceTheMusic module>d, "%s" =FSTMNintendo Wii U BFSTM audio fileaudio/x-bfstmbfstm= magic/audio=.nintendo-3ds-bcstm-fieldsmagic/audio=magic/audio=.^nintendo-3ds-bcstm-fieldsmagic/audio =*FS30Zope Object Database File Storage v4 (data) =)FS21Zope Object Database File Storage v3 (data) = FOVbFoveon X3F raw image dataimage/x-x3fx  , version %d.x  %dx  , %dxx %d =FORMIFF data=AIFF, AIFF audioaudio/x-aiffaiff/aif/aff= AIFC, AIFF-C compressed audioaudio/x-aiff="8SVX, 8SVX 8-bit sampled sound voiceaudio/x-aiff=$16SV, 16SV 16-bit sampled sound voice=%SAMP, SAMP sampled audio=&MAUD, MAUD MacroSystem audio='SMUS, SMUS simple music=(CMUS, CMUS complex music=*ILBMBMHD, ILBM interleaved imagex+, %d xx,%d=-RGBN, RGBN 12-bit RGB image=.RGB8, RGB8 24-bit RGB image=/DEEP, DEEP TVPaint/XiPaint image=0DR2D, DR2D 2-D object=1TDDD, TDDD 3-D rendering=2LWOB, LWOB 3-D object=3LWO2, LWO2 3-D object, v2=4LWLO, LWLO 3-D layered object=5REAL, REAL Real3D rendering=6MC4D, MC4D MaxonCinema4D rendering=7ANIM, ANIM animation=8YAFA, YAFA animation=9SSA , SSA super smooth animation=:FANT, Fantavision animation=;ACBM, ACBM continuous image=<FAXX, FAXX fax image==STFX, ST-Fax image=>IMAGIHDR, CD-i image=@FTXT, FTXT formatted text=ACTLG, CTLG message catalog=BPREF, PREF preferences=CDTYP, DTYP datatype description=GPTCH, PTCH binary patchpatch/pch=LAMFF, AMFF AmigaMetaFile format=MWZRD, WZRD StormWIZARD resource=NDOC , DOC desktop publishing document=OSWRT, SWRT Final Copy/Writer document=PWORD, ProWrite document=QWTXT, WTXT Wordworth document=RWOWO, WOWO Wordworth document=SWVQA, Westwood Studios VQA Multimedia,x T%d video frames,x U%d xx V%d=WMOVE, Wing Commander III Video= X_PC_, PC version= Y3DO_, 3DO version=bIFRS, Blorb Interactive Fiction=cExecwith executable chunk=dIFZS, Z-machine or Glulx saved game file (Quetzal)application/x-blorb = FMRISO/IEC 19794-2 Format Minutiae Record (FMR) =^FMK!FM Kingtracker Song =6FLVMacromedia Flash Videovideo/x-flv =FLIFFLIF<Himage datax , %ux x%u= 1, 8-bit/color,= 2, 16-bit/color,= 1, grayscale, non-interlaced=3, RGB, non-interlaced=4, RGBA, non-interlaced=A, grayscale=C, RGB, interlaced=D, RGBA, interlaced>H, animation data<, %i framesx, %ux x%u=1, 8-bit/color=2, 16-bit/color=magic/flifx, %i frames,x , %ux x%u=1, 8-bit/color=2, 16-bit/color=Q, grayscale, non-interlaced= S, RGB, non-interlaced=!T, RGBA, non-interlaced="a, grayscale=#c, RGB, interlaced=$d, RGBA, interlaced =dFILMSega FILM/CPK Multimedia,x e%d xxf%d =FC14Future Composer 1.4 Module sound file =FATXFATX filesystem data =oEMODExtended MOD sound data,xpversion %dxq.%d,x-r%d instruments=Ss(module)=St(song) = EGGAEGG archive data,eggx version %ux .%u=  "magic/archive=  b$, split=  `$, solidx , unknown =DrawRISC OS Draw file data =DanMMicrosoft Paint image data (version 1.x)x (%dx x %d) =DSMDynamic Studio Module DSM =DSD DSF audio bitstream dataaudio/x-dsfdsf=fmt magic/audio =  magic/audiox, 1 bit= , mono= , stereo= , 3.0 stereo= , 4.0 surround= , 3.1 stereo= , 5.0 surround= , 5.1 surroundxmagic/audiox , %u channelsx, =  Dmagic/audiox D"DSD %u" x %u Hzx"magic/audio= #, no compressionx$, unknown compressionx', ID3!(magic/audio=)ID3version 2x*.%ux+.%ux-unreachablex.missingx1, unknown version =DSBBSurfer 6 binary grid filex , %dx x%dx&, minx=%gx&, maxx=%gx&, miny=%gx& , maxy=%gx&(, minz=%gx&0, maxz=%g = DMS!DMS archive data =DMDLDigiTrakker MDL Module =DKIFDuck IVF video filevideo/x-ivf> , version %dx, codec %sx , %dx x%d> , %d frames = DISODelta ISO data,x version %d =DIRCGit index>, version %d>, %d entries =HDEMGBiosig/DEMGbiosig/demg =DDMFXtracker DMF Modulexv%i> Title: "%s">+Composer: "%s" =zDCU1Borland Delphi .DCU file =DBPFMaxis Database Packed Filex  , version: %u.x  %ux $ , files: %u!  , created: %s!  , modified: %sapplication/x-maxis-dbpfdbpf/package/dat/sc4 =DBM0DIGI Booster Pro Module>V%X.x%02X>, "%s" =4 Cr24Google Chrome extensionapplication/x-chrome-extensionx6 , version %u =CWAVNintendo 3DS BCWAV audio fileaudio/x-bcwavbcwav= magic/audio=.nintendo-3ds-bcwav-fieldsmagic/audio=magic/audio=.^nintendo-3ds-bcwav-fieldsmagic/audio =CUBEMap file for cube and cube2 engine games =^CTMFCreative Music (CMF) dataaudio/x-unknown =CSTMNintendo 3DS BCSTM audio fileaudio/x-bcstmbcstm= magic/audio=.nintendo-3ds-bcstm-fieldsmagic/audio=magic/audio=.^nintendo-3ds-bcstm-fieldsmagic/audio =CSBKTed Neslson's CosmicBook hypertext file =CRfsCOBALT boot rom data (Flat boot rom or file system) =CREGMS Windows 95/98/ME registry file ==CRAMCRAM>>version %d.>?%d>@(identified as %s) = CPCCartesian Perceptual Compression imageimage/x-cpicpi/cpc = CPCHLLVM Pre-compiled header file =CON Microsoft Xbox 360 package (console-signed)=.xbox-360-packagemagic/console =eCIV6Sid Meier's Civilization VI saved game =MCC2xCheeseCutter 2 song = C565OLPC firmware icon image datax  %u xx  %u =BSABSArc archive datax version %d =(BPS1BPS patch filebps =# BPGBPG (Better Portable Graphics)image/bpg =BIX0BIX archive data =BHBlakHole archive data =BCLLVM IR bitcode =pBBCDBBC Dirac Video =+BAMSAMtools BAM (Binary Sequence Alignment/Map)> ,magic/bioinformatics= -^[@]HD .*VN:, with SAM header=.[0-9.]+ version %s> /, with %d reference sequences =6BAISAMtools BAI (BAM indexing format)> 7, with %d reference sequences =!AxGrBiosig/AXG =zArCFreeArc archive =AmSpAMOS Basic sprite bankx, %d sprites =AmIcAMOS Basic icon bankx, %d icons =AmBsAMOS Basic memory banksx, %d banks =AmBkAMOS Basic memory bankx, bank number %dx, length %d= .{8}, type %s =AiAi32 archive dataapplication/x-compress-aiaix "%s"=, solid mode =AiAi32 archive dataapplication/x-compress-aiaix  "%s"! , at 5 %#x! , at 6 %#x!, at 7 %#x =ATF Biosig/Axon Text formatbiosig/atf = ARRIARRI ARI image data,=  4Vxlittle-endian,=  xV4big-endian,x  version %d,x  %dxx  %d ="ARP.The Holy Noise Module sound file =NAMVSMTV Multimedia File = ALZALZ archive dataalz =ADU2Biosig/Axona file formatbiosig/axona =ADU1Biosig/Axona file formatbiosig/axona =ADIFMPEG ADIF, AACaudio/x-hx-aac-adif&magic/animation& , VBR^ , CBR=, single stream= , 2 streams=!, 3 streams&", 4 or more streams&#, 8 or more streams&$, Copyrighted& %@, Original Source& & , Home Flag^'magic/animation&(, VBR^), CBR=*, single stream=+, 2 streams=,, 3 streams&-, 4 or more streams&., 8 or more streams&/@, Original Stream(s)&0 , Home Source =ACMPMap file for the AssaultCube FPS game =ABF Biosig/Axon Binary formatbiosig/abf2 =@CT T602 document data,=0Kamenicky=1CP 852= 2KOI8-CS> 2unknown encoding =System V Release 1 ar archiveapplication/x-archive =ek0(%-0.4s) =BD<, Brutal Deluxe's Cadius=CdrP, CiderPress=Vi][, Virtual ][=PRFS, ProFUSE=FISH, FishWings=RVLW, Revival for Windowsxmagic/applex, Creator tag "%-4.4s"= , DOS 3.3 sector order=, Volume 254x, Volume %u= , ProDOS sector order=@magic/apple&Dmagic/applexE, Volume /%sx i, %u Blocks= , NIB data = 2GXTGTA in-game text (GXT2), used in GTA V =%2BITAudio Visual Research file,= &mono,= 'stereo,x(%d bits=)unsigned,=*signed,x+%d Hz,=,no loop,=-loop,<.note %d,=/replay 5.485 KHz=0replay 8.084 KHz=1replay 10.971 KHz=2replay 16.168 KHz=3replay 21.942 KHz=4replay 32.336 KHz=5replay 43.885 KHz=6replay 47.261 KHz = 2278Aster*x Version 2=6Words Document=5Graphic=2Spreadsheet=8Macro =1giMWindows Easy Transfer migration dataapplication/x-ms-migmig=MRTSwithout passwordx 8, at %#x  x 8magic/windowsx)magic/windows!MRTSwith password=@MRTSmagic/windowsx, 1st %-s = .sndSun/NeXT audio data:= 8-bit ISDN mu-law,audio/basic= 8-bit linear PCM [REF-PCM],audio/basic= 16-bit linear PCM,audio/basic= 24-bit linear PCM,audio/basic= 32-bit linear PCM,audio/basic= 32-bit IEEE floating point,audio/basic= 64-bit IEEE floating point,audio/basic= Fragmented sample data,=  DSP program,=  8-bit fixed point,=  16-bit fixed point,=  24-bit fixed point,= 32-bit fixed point,= 16-bit linear with emphasis,= !16-bit linear compressed,= "16-bit linear with emphasis and compression,= #Music kit DSP commands,= $8-bit ISDN mu-law compressed (CCITT G.721 ADPCM voice enc.),audio/x-adpcm= &compressed (8-bit CCITT G.722 ADPCM)= 'compressed (3-bit CCITT G.723.3 ADPCM),= (compressed (5-bit CCITT G.723.5 ADPCM),= )8-bit A-law (CCITT G.711),=*mono,=+stereo,=,quad,>-%d Hz =.keyAmigaDOS script =.MDPMicroDesign page data=0version 2=3version 3 =.MDAMicroDesign data=0version 2=3version 3 =.KEYAmigaDOS script =E-H2ODRY archive data =I,AR7AR7 archive data = +/v9Unicode text, UTF-7 =+/v8Unicode text, UTF-7 = +/v/Unicode text, UTF-7 = +/v+Unicode text, UTF-7 =*STAAster*x= WORDWords Document= GRAPGraphic= SPRESpreadsheet= MACRMacro =h$HSFXSE multibeam =$FL3SPSS System Filex%s =$FL2SPSS System Filex%s =#X3DX3D (Extensible 3D) model, VRML format=Vmagic/cad=[0-9.]+, version %smodel/x3d+vrmlx3dv =n#LyXLyX document text =LuaLua bytecode,=#version 2.4=%version 2.5/3.0=1version 3.1=2version 3.2=@version 4.0=Pversion 5.0=Qversion 5.1=Rversion 5.2=Sversion 5.3=Tversion 5.4 =QFQFC archive data =FCQFC archive data = $Oric tape,= BASIC,= memory block,> autorun,x "%.15s" =FIGDeskMate Drawingimage/x-deskmate-figfig =|]eInstallShield Z archive Data = Cytovision FISH Probe file =VNFVisual Networks traffic capture file =qTerse archive data =<RVPPowerVR 3.0 texture: BE,x=%u xx>%u> ?x %ux@,= Amagic/images=.Bpvr3-pixel-formatmagic/images! Cmagic/images! D%c!E%u! F%c!G%u! H%c! I%u!J%c! K%u=L, sRGB=M, premultiplied alpha =vAB2ABComp archive data =n'Biosig/RHD2000: Intan RHD2000 format =MSVC .bsc =wgpgGPG key trust databasexxversion %d =fcpX11 Portable Compiled Font data,^ bit: LSB,& bit: MSB,^ byte: LSB first& byte: MSB first =% Minix-386 executable!&not stripped = Linux-8086 executable!not stripped =#Minix-386 impure executable!$not stripped =Linux-8086 impure executable!not stripped ='Minix-386 NSYM/GNU executable!(not stripped = asmWebAssembly (wasm) binary module= version %#x (MVP)application/wasmwasm> version %#x =PPFT archive data =W MRMMinolta Dimage camera raw image data = BINetscape Communicator address book = Unicode text, UTF-32, big-endian =[$Maple something=`EAn old revision=aRThe latest save = \n8 Unix Fast File system [v2ea] (little-endian)=.offsv2magic/filesystems = \qTUnix Fast File system [v2] (little-endian)=.rffsv2magic/filesystems = \%PTUnix Fast File system [v1] (little-endian),=.Qffsv1magic/filesystems = \z8 Unix Fast File system [v2ea] (little-endian)=.{ffsv2magic/filesystems = \}TUnix Fast File system [v2] (little-endian)=.~ffsv2magic/filesystems = 8ARMdLinux kernel ARM64 boot executable Image^ , little-endian& , big-endian& , 4K pages&  , 16K pages&  , 32K pages = $(oLinux kernel ARM boot executable zImage= .arm-zimagemagic/linux =  1SFBBE/OS BFS1 filesystemx $ , byte order %dx ( , block size %dx , , block shift %dx0 , total blocks %lldx8! , used blocks %lld = Lkold-fs dump file (little endian),= .M^old-dump-bemagic/dump = STnew-fs dump file (ufs2, little endian),= .T^ufs2-dump-bemagic/dump =  BoltDB database = ZIntel serial flash for PCH ROM = RISC OS AIF executable = Y Berkeley DB> Z(Log, version %d, little-endian) = Jb1Berkeley DB> K(Btree, version %d, little-endian) = CaBerkeley DB> D(Hash, version %d, little-endian) = QS"Berkeley DB> R(Queue, version %d, little-endian) =  Symbian installation fileapplication/vnd.symbian.install=  m(EPOC release 3/4/5)=  :(EPOC release 6) =  N,+GVXL data file,> schema version no %d = N+Linux Software RAIDx version 1.2 (%d)= .linuxraidmagic/linux = S EROFS filesystem> U , compat:& V SB_CHKSUM& W MTIMEx X , blocksize=%ux Y , exslots=%ux10a , uuid=%s>@b 0, name=%s> Pc , incompat:& Pd LZ4_0PADDING& Pe BIG_PCLUSTER& Pf CHUNKED_FILE& Pg DEVICE_TABLE& Ph ZTAILPACKING =  F2FS filesystemxl, UUID=%08xxp-%04xxr-%04xxt-%04xxv-%08xxz%04xx|, volume name "%s" = kFreeBSD/i386 compact demand paged< lmagic/freebsd&mshared library=n@PIC object=oobject> pmagic/freebsd=qdynamically linked executable=rexecutable> snot stripped = a FreeBSD/i386 demand paged< bmagic/freebsd&cshared library=d@PIC object=eobject> fmagic/freebsd=gdynamically linked executable=hexecutable> inot stripped = WFreeBSD/i386 pure< Xmagic/freebsd&Yshared library=Z@PIC object=[object> \magic/freebsd=]dynamically linked executable=^executable> _not stripped = MFreeBSD/i386< Nmagic/freebsd&Oshared library=P@PIC object=Qobject> Rmagic/freebsd=Sdynamically linked executable=Texecutable> Unot stripped = aHHYP archive dataapplication/x-arc = _ARC+ archive dataapplication/x-arc = ] PAK archive dataapplication/x-arc = R ARC archive data, squashedapplication/x-arc = PARC archive data, dynamic LZWapplication/x-arc = ZARC archive data, crunchedapplication/x-arc = XARC archive data, squeezedapplication/x-arc = VARC archive data, packedapplication/x-arc = TARC archive data, uncompressedapplication/x-arc = Linux-8086 executable!, unmapped zero page= , impure! magic/linux!, A_EXEC!, A_PAL!, A_NSYM!, A_STAND! @, A_PURE!!, A_TOVLY!", not stripped=%#.magic/linux>$$, libc version %s = Linux-Dev86 executable, headerless=.magic/linux>, libc version %s = N+Linux Software RAIDx version 1.1 (%d)= .linuxraidmagic/linux = Bitcoin= (reverse blockx  , size %ux blockx  , size %u=  magic/cryptox , BIP9 0x%x!  magic/cryptox , version 0x%xx L, %s UTC<X, txcount %u=Xmagic/cryptox Y, txcount %u=Xmagic/cryptox Y, txcount %u=Xmagic/cryptoxY, txcount %lludat = PDP-11 4.0 archive = PDP-11 old archive = 0BALANCE NS32000 standalone executable> not stripped> |version %d =  BALANCE NS32000 executable (invalid @ 0)> not stripped> |version %d = BALANCE NS32000 executable (0 @ 0)>  not stripped> | version %d = BALANCE NS32000 .o>  not stripped> | version %d =  LLVM bitcode, wrapper= x86_64= i386= ppc= ppc64=  arm = *Java module image (little endian)> +, version %dx ,.%dapplication/x-java-image = ϚWGNU dbm 1.x or ndbm database, little endian, 64-bitapplication/x-gdbm =  SCO UnixWare BFS filesystem = ΚWGNU dbm 1.x or ndbm database, little endian, oldapplication/x-gdbm = CΊFBochs Sparse disk image = ͫMLSSA datafile,x algorithm %d,x %d samples = ͚WGNU dbm 1.x or ndbm database, little endian, 32-bitapplication/x-gdbm = dLinux/i386 demand-paged executable (QMAGIC)= , stripped = i386 compact demand paged pure executable>  not stripped= j(uses shared libs) = RISC OS Chunk data= OBJ_, AOF object= LIB_, ALF library = ıAndroid cryptfs footerx , version: %dx .%d = *Unreal Engine package (little-endian)xxx/tfc/upk/me1/u! , version %u! /%03u= . upk_headermagic/games = Common Trace Format (CTF) trace data (LE) = |SE Linux modular policyx version %d,x %d sections,= |magic/selinuxx   mod version %d,=   Not MLS,=   MLS,=   magic/selinux>  /module name %s=  base = 9|SE Linux policyx :v%d= ;MLSx <%d symbolsx =%d ocons = ECOFF NetBSD/alpha binary= not stripped= stripped = ,~ST40 component image format>-, name '%s' = z Symbian installation file (Symbian OS 9.x)x-epoc/x-sisx-app = UzPsion Series 5 executable = =yPsion Series 5 binary:= >DLLapplication/x-epoc-dll= @Icomms hardware libraryapplication/x-epoc-chlib= BJcomms protocol libraryapplication/x-epoc-cplib= D]OPXapplication/x-epoc-opx= Flapplicationapplication/x-epoc-app= HDLLapplication/x-epoc-dll= Jlogical device driverapplication/x-epoc-ldd= Lphysical device driverapplication/x-epoc-pdd= Nfile transfer protocolapplication/x-epoc-ftp= P@printer definitionapplication/x-epoc-ppd= RAprinter definitionapplication/x-epoc-ppd = Lx>"Transport Neutral Encapsulation Format (TNEF)application/vnd.ms-tneftnef/dat!T, 1st level %#2.2x!V, 1st id %#8.8x=Wmagic/mail.news! Y, TnefVersion length %x! [, version %#8.8x! ], checksum %#4.4x!_, level %#2.2x=a, OEM codepage= cmagic/mail.newsx e%u! "gand %ux &i(checksum %#x)!(k, level %u=)m, MessageAttributex -r"%s" = pkTurboC BGI file = oVAX single precision APL workspace = oncgGCC gcno coverage (-ftest-coverage),xversion %c.x%c = nVAX double precision APL workspace = mvery old 32-bit-int little-endian archive = mPDP-11 single precision APL workspace = lPDP-11 double precision APL workspace = iHDLld.so hints file (Little Endian> , version %d)<) = eold 32-bit-int little-endian archive= __.SYMDEFrandom library = b9mdbm file, version 0 (obsolete) = <b1Berkeley DB 1.85/1.86> =(Btree, version %d, little-endian) = & bLFS filesystem image= ' version 1,x ( blocks %u,x ) blocks per segment %u,= * version 2,x + fragments %u,x , bytes per segment %u,x - disk blocks %u,x . block size %u,x / fragment size %u,x 0 fragments per block %u,x 1 start for free list %u,x $2 number of free blocks %d,x (3 number of files %u,x ,4 blocks available for writing %d,x 05 inodes in cache %d,x 46 inode file disk address %#x,x 87 inode file inode number %u,x <8 address of last segment written %#x,x @9 address of next segment to write %#x,x D: address of current segment written %#x = )adcgGCC gcda coverage (-fprofile-arcs),x*version %c.x+%c = ZIntel serial flash for ICH/PCH ROM <= 5 or 3400 series A-step = WuCommon Trace Format (CTF) packetized metadata (LE)x#, v%dx$.%d = PKTurboC Font file = 0PPsion Series 5= 1mdatabase= 2Agenda fileapplication/x-epoc-agenda= 4Address bookapplication/x-epoc-addressbook= 6 Jotter fileapplication/x-epoc-jotter= 8ini fileapplication/x-epoc-ini= :uBacklite fileapplication/x-epoc-backlite = E=(Linux Compressed ROM File System data, little endianx size %u& version #2& sorted_dirs& hole_supportx CRC %#x,x $edition %u,x (%u blocks,x ,%u files = -APsion Series 5 ROM multi-bitmap imageimage/x-epoc-mbm = ~@YUCRIU service file = .=SYSLINUX' LSS16 image dataimage/x-lss16x 1, width %dx 2, height %d = :&Android sparse imagex , version: %dx .%dx , Total of %dx %d-byte output blocks inx  %d input chunks. = h70Zstandard dictionaryapplication/x-std-dictionaryx j(ID %u) = 7Psion Series 5=  9font fileapplication/x-epoc-font=  :printer driverapplication/x-epoc-pdriver= ;clipboardapplication/x-epoc-clipboard= Bmulti-bitmap imageimage/x-epoc-mbm= japplication information file= mRecord fileimage/x-epoc-record= }Sketch imageimage/x-epoc-sketch= ~voice noteapplication/x-epoc-voice= Word fileapplication/x-epoc-word= OPL program (TextEd)application/x-epoc-opl= Data fileapplication/x-epoc-data= Comms settings=  Sheet fileapplication/x-epoc-sheet= "EasyFax initialisation fileapplication/x-epoc-eini= $sOPO moduleapplication/x-epoc-opo= &tOPL applicationapplication/x-epoc-app= (exported multi-bitmap imageimage/x-epoc-xmbm= *mmagic/epoc= +Comms names = 6Netboot image,= magic/filesystems= mode 2= mode 3! unknown mode = ~4UValve Pak filex , version %ux , tree size %u x , file data size %u x , archive MD5 size %u x , other MD5 size %u x $, signature size %u = 1VwpCracklib password index, little endian>(%i words)=("64-bit")> (%i words) = 1.sdDEC audio data:= 28-bit ISDN mu-law,audio/x-dec-basic= 48-bit linear PCM [REF-PCM],audio/x-dec-basic= 616-bit linear PCM,audio/x-dec-basic= 824-bit linear PCM,audio/x-dec-basic= :32-bit linear PCM,audio/x-dec-basic= <32-bit IEEE floating point,audio/x-dec-basic= >64-bit IEEE floating point,audio/x-dec-basic= @Fragmented sample data,= A DSP program,= B 8-bit fixed point,= C 16-bit fixed point,= D 24-bit fixed point,= E32-bit fixed point,= F16-bit linear with emphasis,= G16-bit linear compressed,= H16-bit linear with emphasis and compression,= IMusic kit DSP commands,= J8-bit ISDN mu-law compressed (CCITT G.721 ADPCM voice enc.),audio/x-dec-basic= Lcompressed (8-bit CCITT G.722 ADPCM)= Mcompressed (3-bit CCITT G.723.3 ADPCM),= Ncompressed (5-bit CCITT G.723.5 ADPCM),= O8-bit A-law (CCITT G.711),= Pmono,= Qstereo,= Rquad,> S%d Hz = b(/Zstandard compressed data (v0.8+)application/zstdzst=.ezstd-dictionary-idmagic/compress = ^'/Zstandard compressed data (v0.7)application/zstdzst=.azstd-dictionary-idmagic/compress = [&/Zstandard compressed data (v0.6)application/zstdzst = X%/Zstandard compressed data (v0.5)application/zstdzst = U$/Zstandard compressed data (v0.4)application/zstdzst = w$1Eiproute2 routes dump = $ gconv module configuration cache data = R#/Zstandard compressed data (v0.3)application/zstdzst = O"/Zstandard compressed data (v0.2)application/zstdzst = x"6Giproute2 addresses dump = Wmagic binary file for file(1) cmdapplication/x-filemgcx [(version %d) (little endian) = }CVTCRIU image file v1.1 = 11XCRIU inventory = a.out VAX demand paged (first page unmapped) pure executable> not stripped =  dLinux/i386 demand-paged executable (ZMAGIC)= , stripped =  a.out little-endian 32-bit demand paged pure executable> not stripped= j(uses BSD/OS shared libs) =  locale archivex %d strings = dLinux/i386 pure executable (NMAGIC)= , stripped = a.out little-endian 32-bit pure executable> not stripped= j(uses BSD/OS shared libs) = dLinux/i386 impure executable (OMAGIC)= , stripped = a.out little-endian 32-bit executable> not stripped= j(uses BSD/OS shared libs) = 7MIPS OpenFirmware FORTH Dictionary,x 8Text length: %d bytes,x 9Data length: %d bytes,x :BSS length: %d bytes,x ;Symbol Table length: %d bytes,x <Entry Point: %#08X,x =Text Relocation Table length: %d bytes,x >Data Relocation Table length: %d bytes = b.out& overlay& separate& pure& segmented& standalone& executable^ object file& @V2.3& V3.0&8086& i186& i286&)i286& i386& Large Text& Large Data& Huge Objects Enabled = *"MLZ4 compressed data (v1.4+)application/x-lz4lz4 = ٢Keepass password database=  eK1.x KDB> 0 , %d groups> 4, %d entries= , SHA-256= , AES= , RC4= , Twofish> x, %d key transformation rounds= gK2.x KDBX = .!LLZ4 compressed data (v1.0-v1.3)application/x-lz4 = }SpeedShop data file = #Khronos SPIR-V binary, little-endianx , version %#08xx , generator %#08x = 0!LLZ4 compressed data (v0.1-v0.9)application/x-lz4 =\t8 Unix Fast File system [v2ea] (little-endian)=.u^ffsv2magic/filesystems =\wTUnix Fast File system [v2] (big-endian)=.x^ffsv2magic/filesystems =\%STUnix Fast File system [v1] (big-endian),=TLBALApple UFS VolumexUnamed %s,xVvolume label version %d,x Wcreated on %s,=.X^ffsv1magic/filesystems =\8 Unix Fast File system [v2ea] (little-endian)=.^ffsv2magic/filesystems =\TUnix Fast File system [v2] (big-endian)=.^ffsv2magic/filesystems =$(oLinux kernel ARM boot executable zImage= .arm-zimagemagic/linux ==3Nintendo GameCube disc image:application/x-gamecube-rom=.nintendo-gcn-disc-commonmagic/console =]Nintendo Wii disc image:=.nintendo-gcn-disc-commonmagic/console ="ndump format, Convex Storage Manager by-reference dump =!mdump format, 4.2 or 4.3 BSD (IDC compatible) =Alnew-fs dump file (big endian),= .Bnew-dump-bemagic/dump =Dkold-fs dump file (big endian),= .Eold-dump-bemagic/dump =PTnew-fs dump file (ufs2, big endian),= .Qufs2-dump-bemagic/dump = BoltDB database, big-endian = W Berkeley DB>X(Log, version %d, big-endian) = Hb1Berkeley DB>I(Btree, version %d, big-endian) = AaBerkeley DB>B(Hash, version %d, big-endian) = OS"Berkeley DB>P(Queue, version %d, big-endian) = H+zX11/NeWS font family = E+zX11/NeWS bitmap font =DIVDOS code page font data (from Linux?) =AGEDOS code page font data = JQDOS executablex !'%s' =M&PPCP archivexN(V.%d)=Otemporal index=Pmetadata=Qlog volume #0>Rlog volume #%d>Shost: %s =T&P(PCP archivexU(V.%d)=Vtemporal index=Wmetadata=Xlog volume #0>Ylog volume #%d>$Zhost: %s =e AD71 Image =eAD64 Image = D(D81 Image ='FAtari-ST Minix kernel image=  , 720k floppy=   , 360k floppy =eDBTS archive data =Ga.out NetBSD/vax 4k core= .netbsd-coremagic/netbsd =iGa.out NetBSD/powerpc core= .jnetbsd-coremagic/netbsd =Ga.out NetBSD/arm core= .netbsd-coremagic/netbsd =Ga.out NetBSD/mips core= .netbsd-coremagic/netbsd =Ga.out NetBSD/alpha core> from '%s'! (signal %d) =Ga.out NetBSD/vax 1k core= .netbsd-coremagic/netbsd =Ga.out NetBSD/pmax core= .netbsd-coremagic/netbsd =uGa.out NetBSD/SPARC core= .v^netbsd-coremagic/netbsd =fGa.out NetBSD/ns32532 core= .gnetbsd-coremagic/netbsd =ZGa.out NetBSD/m68k4k core= .[^netbsd-coremagic/netbsd =NGa.out NetBSD/m68k core= .O^netbsd-coremagic/netbsd =BGa.out NetBSD/i386 core= .Cnetbsd-coremagic/netbsd = a.out NetBSD/vax 4k demand paged= .netbsd-4096magic/netbsd = a.out NetBSD/arm32 demand paged= .netbsd-4096magic/netbsd = a.out NetBSD/mips demand paged= .^netbsd-8192magic/netbsd>not stripped = a.out NetBSD/vax 1k demand paged= .netbsd-4096magic/netbsd =x a.out NetBSD/pmax demand paged= .ynetbsd-4096magic/netbsd =l a.out NetBSD/SPARC demand paged= .m^netbsd-8192magic/netbsd =] a.out NetBSD/ns32532 demand paged= .^netbsd-4096magic/netbsd =Q a.out NetBSD/m68k4k demand paged= .R^netbsd-4096magic/netbsd =E a.out NetBSD/m68k demand paged= .F^netbsd-8192magic/netbsd =9 a.out NetBSD/i386 demand paged= .:netbsd-4096magic/netbsd =a.out NetBSD/vax 4k pure= .netbsd-puremagic/netbsd =a.out NetBSD/arm32 pure= .netbsd-puremagic/netbsd =a.out NetBSD/mips pure= .netbsd-puremagic/netbsd =a.out NetBSD/vax 1k pure= .netbsd-puremagic/netbsd ={a.out NetBSD/pmax pure= .|^netbsd-puremagic/netbsd =oa.out NetBSD/SPARC pure= .p^netbsd-puremagic/netbsd =`a.out NetBSD/ns32532 pure= .anetbsd-puremagic/netbsd =Ta.out NetBSD/m68k4k pure= .U^netbsd-puremagic/netbsd =Ha.out NetBSD/m68k pure= .I^netbsd-puremagic/netbsd =<a.out NetBSD/i386 pure= .=netbsd-puremagic/netbsd =a.out NetBSD/vax 4k= .netbsd-normalmagic/netbsd =a.out NetBSD/arm32= .netbsd-normalmagic/netbsd =a.out NetBSD/mips= .netbsd-normalmagic/netbsd =a.out NetBSD/vax 1k= .netbsd-normalmagic/netbsd =~a.out NetBSD/pmax= .netbsd-normalmagic/netbsd =ra.out NetBSD/SPARC=.s^netbsd-normalmagic/netbsd =ca.out NetBSD/ns32532= .dnetbsd-normalmagic/netbsd =Wa.out NetBSD/m68k4k=.X^netbsd-normalmagic/netbsd =Ka.out NetBSD/m68k=.L^netbsd-normalmagic/netbsd =?a.out NetBSD/i386= .@netbsd-normalmagic/netbsd = SPARC demand paged&magic/bsdi<shared library=dynamically linked executable>dynamically linked executable/^executable>not stripped=$(uses shared libs) = a.out SunOS mc68020 demand paged& magic/sun<!shared library="dynamically linked executable>#dynamically linked executable^$executable>%not stripped =1 a.out SunOS mc68010 demand paged&2magic/sun<3shared library=4dynamically linked executable>5dynamically linked executable^6executable>7not stripped =a.out SunOS SPARC pure&dynamically linked executable^executable>not stripped =SPARC pure&dynamically linked executable^executable>not stripped=$ (uses shared libs) ='a.out SunOS mc68020 pure&(dynamically linked executable^)executable>*not stripped =9a.out SunOS mc68010 pure&:dynamically linked executable^;executable><not stripped =a.out SunOS SPARC&dynamically linked executable^executable>not stripped ="SPARC&#dynamically linked executable^$executable>%not stripped=$&(uses shared libs) =,a.out SunOS mc68020&-dynamically linked executable^.executable>/not stripped =>a.out SunOS mc68010&?dynamically linked executable^@executable>Anot stripped =dApple Mechanic font =ʏNetBSD kernel core file=, Unknown=, sun 68010/68020=, sun 68020=d, 386 PC=, i386 BSD=, m68k BSD (8K pages)=, m68k BSD (4K pages)=, ns32532 BSD=, SPARC/32 BSD=, pmax BSD=, vax BSD (1K pages)=, alpha BSD=, mips BSD (Big Endian)=, arm6 BSD=, m68k BSD (2K pages)=, sh3 BSD=, ppc BSD (Big Endian)=, vax BSD (4K pages)=, mips1 BSD=, mips2 BSD=, m88k BSD=, parisc BSD=, sh5/64 BSD=, SPARC/64 BSD=, amd64 BSD=, sh5/32 BSD=, ia64 BSD=, aarch64 BSD=, or1k BSD=, Risk-V BSD=, hp200 BSD=,, hp300 BSD= , hp800 HP-UX= , hp200/hp300 HP-UX=, CPU=, DATA=, STACKx , (headersize = %dx , segmentsize = %dx , segments = %d) = 7SQLite Write-Ahead Log,sqlite-wal/db-walx"version %d =AHHA archive data= 1 file,> %u files,=first is type CPY=first is type ASC=first is type HSC=first is type DIR=first is type SPECIAL =00zyDeepFreezer archive data =5`Atari ST M68K non-contig executablex6(txt=%d,x7dat=%d,x 8bss=%d,x9sym=%d) =0`Atari ST M68K contiguous executablex1(txt=%d,x2dat=%d,x 3bss=%d,x4sym=%d) =SMMSXiE archive data =%URaspberry PI EEPROMapplication/x-raspberry-eeprombinx+, offset %8.8x!., length %x> 00, "%s"=2magic/rpi!4, 2nd MAGIC=%8.8x = cisco IOS experimental microcode> for '%s' = cisco IOS microcode> for '%s' =: MySQL Maria compressed data filex;Version %d =8 MySQL Maria index filex9Version %d =6MySQL MyISAM compressed data filex7Version %d =/MySQL MyISAM index filex0Version %dx1, %d key partsx2, %d unique key partsx3, %d keysx4, %lld recordsx$5, %lld deleted records =-MySQL ISAM compressed data filex.Version %d =+MySQL ISAM index filex,Version %d =DIFvideo/x-dv&(DVCPRO) movie file^(DV) movie file&(PAL)^(NTSC) =0BSSBX archive data = vCDC Codec archive data =LBWRAptor packer (c64) =Sun 'jks' Java Keystore File data =war.RealAudio sound fileaudio/x-pn-realaudio = AmigaOS shared library =AIX compiled message catalog = JPEG-LS image dataimage/jlsjls=.jpegmagic/jpeg =)Adobe InDesign=*DOCUMENTDocument = AmigaOS loadseg()ble executable/binary = Java KeyStoreapplication/x-java-keystore =Plan 9 executable, PowerPC = Plan 9 executable, Intel i386 =o AIX backup/restore format file =k AIX backup/restore format file = AmigaOS object/library data =RPMapplication/x-rpmx v%dx .%d= src= bin= i386/x86_64=Alpha/Sparc64=Sparc=MIPS=PowerPC=68000=SGI=RS6000= IA64= Sparc64= MIPSel= ARM= MiNT=S/390=S/390x=PowerPC64=SuperH=Xtensa=AArch64= MIPSr6=!MIPS64r6="RISC-V64=#LoongArch64=$noarch =%Java module image (big endian)>&, version %dx'.%dapplication/x-java-image =ϚWGNU dbm 1.x or ndbm database, big endian, 64-bitapplication/x-gdbm =Java JCE KeyStoreapplication/x-java-jce-keystore =ΚWGNU dbm 1.x or ndbm database, big endian, oldapplication/x-gdbm = ͚WGNU dbm 1.x or ndbm database, big endian, 32-bitapplication/x-gdbm = *Unreal Engine package (big-endian)xxx/tfc! , version %u!/%03u= .^upk_headermagic/games = Common Trace Format (CTF) trace data (BE) = Mac OS X Detached Code Signature>(%d elements)x- %d bytes = Mac OS X Detached Code Signature (non-executable)x- %d bytes =IRIX Parallel Arena>- version %d =*IRIX N32 core dump=+of>,'%s' = ?Conary changeset data ="IRIX core dump=#of>$'%s' =,POWER boot firmware=-0 H(PHYP entry point) =Plan 9 executable, AMD 29000 = Plan 9 executable, SPARC =EEBML file=d@Bmagic/ebmlx, creator %.8s =Plan 9 executable, MIPS R4000 LE =Plan 9 executable, AT&T Hobbit = Plan 9 executable, AT&T DSP 3210 =;Convex SOFF checkpoint=X<c1&X=c2&X>c2mp&X?parallel&X@intrinsic&XAPOSIX=TCnative fpmode=TDieee fpmode=TEundefined fpmode =9Convex SOFF core ='Convex SOFF=X(c1&X)c2&X*c2mp&X+parallel&X,intrinsic&X-demand paged&X.pre-paged&X/non-swapped&X0POSIX&T2executable&T3@object=T4 not stripped=T5native fpmode=T6ieee fpmode=T7undefined fpmode = {dar archive,x label "%.8xx %.8xx %.4x"= Tend slice= NNmulti-part= SNmulti-part, with -S ="oncgGCC gcno coverage (-ftest-coverage),x#version %c.x$%c (big-endian) =mvery old 32-bit-int big-endian archive =iHDLld.so hints file (Big Endian>, version %d)<) =eold 32-bit-int big-endian archive= __.SYMDEFrandom library =dIRCAM file (NeXT little-endian) =dIRCAM file (MIPS big-endian) =dIRCAM file (Sun little-endian) =dIRCAM file (VAX big-endian) = dACX64 Image =:b1Berkeley DB 1.85/1.86>;(Btree, version %d, big-endian) =.adcgGCC gcda coverage (-fprofile-arcs),x/version %c.x0%c (big-endian) =.aBerkeley DB=/magic/database>01.86<11.85>2(Hash, version %d, big-endian)=3magic/database>41.86<51.85>6(Hash, version %d, native byte-order) =WuCommon Trace Format (CTF) packetized metadata (BE)x#, v%dx$.%d =WCore file =!V'u-boot legacy uImage,x "%s,=#Invalid os/=$OpenBSD/=%NetBSD/=&FreeBSD/='4.4BSD/=(Linux/=)SVR4/=*Esix/=+Solaris/=, Irix/=- SCO/=. Dell/=/ NCR/=0 LynxOS/=1VxWorks/=2pSOS/=3QNX/=4Firmware/=5RTEMS/=6ARTOS/=7Unity OS/=8INTEGRITY/=9Invalid CPU,=:Alpha,=;ARM,=<Intel x86,==IA64,=>MIPS,=?MIPS 64-bit,=@PowerPC,=AIBM S390,=B SuperH,=C Sparc,=D Sparc 64-bit,=E M68K,=F Nios-32,=GMicroBlaze,=HNios-II,=IBlackfin,=JAVR32,=KSTMicroelectronics ST200,=LSandbox architecture,=MANDES Technology NDS32,=NOpenRISC 1000,=OARM 64-bit,=PDesignWare ARC,=Qx86_64,=RXtensa,=SRISC-V,=TInvalid Image=UStandalone Program=VOS Kernel Image=WRAMDisk Image=XMulti-File Image=YFirmware Image=ZScript File=[Filesystem Image (any type)=\Binary Flat Device Tree BLOB=](Not compressed),=^(gzip),=_(bzip2),=`(lzma),x a%d bytes,x b%s,xcLoad Address: %#08X,xdEntry Point: %#08X,xeHeader CRC: %#08X,xfData CRC: %#08X =GVSunOS core file=H(SPARC)>Ifrom '%s'=tJ(quit)=tK(illegal instruction)=tL(trace trap)=tM(abort)=tN(emulator trap)=tO(arithmetic exception)=tP (kill)=tQ (bus error)=tR (segmentation violation)=tS (bad argument to system call)=tT(resource lost)xxU(T=%dK,x|VD=%dK,xWS=%dK)=X:(68K)>Yfrom '%s'=Z(SPARC 4.x BCP)>[from '%s' =SEGEOS=(executable=(VMFile=( binary=( directory label<( unknown>( unknown> , name "%s" =QOJPEG 2000 codestreamimage/x-jp2-codestreamjpc/j2c/j2k = Q)zencrypted scalable OpenFont binary = P)zscalable OpenFont binary =OConvex old-style pre-paged, non-swapped executable>not stripped =NVRMVMware nvram =NOFDOS code page font data collectionfont/x-dos-cpicpi =uMOOOUser-mode Linux COW file<v, version %d>w, backing file %s>x, version %d> y, backing file %s =MLRResilient Logic bytecodeapplication/vnd.resilient.logicx, version %dx.%d =MFCTIRIS Showcase templatex- version %d =MFCSIRIS Showcase filex- version %d =MConvex old-style pre-paged executable>not stripped =jKRTNMultiTrack sound dataxk- version %d =KPlan 9 executable, DEC Alpha =KConvex old-style demand paged executable>not stripped = G)zNeWS font family =GPlan 9 executable, ARM 7-something = GPlan 9 executable, Intel i960 = GConvex old-style object> not stripped =E=(Linux Compressed ROM File System data, big endianxsize %u&version #2&sorted_dirs&hole_supportx CRC %#x,x$edition %u,x(%u blocks,x, %u files =D)zNeWS bitmap font =BSFXSGI XFS filesystem datax(blksz %d,xhinosz %d,^d v1 dirs)&d v2 dirs) =A SGI disk label (volume header) =&@IRIX 64-bit core dump='of>('%s' =<:Plan 9 object file, MIPS R3000 =<tPlan 9 object file, SPARC =< CPlan 9 object file, AT&T Hobbit =6srrdiff network-delta data =6srrdiff network-delta signature datax(block length=%d,xsignature strength=%d) = 1VwpCracklib password index, big endian> (%i words) =.hlsAllegro datafile (not packed/autodetect) = +hlsAllegro datafile (appended exe data) =(!Sega Dreamcast VMU game image =!hlsAllegro datafile (packed) =  glibc locale file LC_CTYPE = glibc locale file LC_COLLATE = glibc locale file LC_TELEPHONE = glibc locale file LC_MEASUREMENT = glibc locale file LC_NAME = glibc locale file LC_ADDRESS = glibc locale file LC_IDENTIFICATION = glibc locale file LC_TIME = glibc locale file LC_NUMERIC = glibc locale file LC_ALL = glibc locale file LC_PAPER = glibc locale file LC_MONETARY = glibc locale file LC_MESSAGES =. HPowerPC OpenFirmware FORTH Dictionary,x/Text length: %d bytes,x0Data length: %d bytes,x 1BSS length: %d bytes,x2Symbol Table length: %d bytes,x3Entry Point: %#08X,x4Text Relocation Table length: %d bytes,x5Data Relocation Table length: %d bytes = Pulsar POP3 daemon mailbox cache file.x Version: %d.x %d =^magic binary file for file(1) cmdapplication/x-filemgcxb(version %d) (big endian) =YlibGrx font data,x %dxx %dx(%s =Plan 9 executable, MIPS R4000 BE =% POWER Secure Boot Container,x&version %ux'container size %llu=+7zXZXZ compressed =]PA-RISC2.0 shared library>`^- not stripped =EPA-RISC1.1 shared library>`F- not stripped = HP s200 shared library>- version %d>- highwater %d>$not stripped =u PA-RISC1.0 shared library>`v- not stripped =$ GStreamer binary registryx%, version %s =e JAR compressed with pack200,xfversion %d.xg%dapplication/x-java-pack200 =` PA-RISC2.0 dynamic load library>`a- not stripped =H PA-RISC1.1 dynamic load library>`I- not stripped =  HP s200 dynamic load library>- version %d>- highwater %d>$not stripped =x  PA-RISC1.0 dynamic load library>`y- not stripped =X PA-RISC2.0 demand-load executable&Ydynamically linked=Z0Ndynamically linked>`[- not stripped =@ PA-RISC1.1 demand-load executable=Adynamically linked=B0Ndynamically linked>`C- not stripped =  HP s200 demand-load executable>- version %d&save fp regs&@dynamically linked& debuggable>$not stripped =p  PA-RISC1.0 demand-load executable=qdynamically linked=r0Ndynamically linked>`s- not stripped =, a.out big-endian 32-bit demand paged executable>-not stripped = 'ESRI Shapefile=magic/esri= magic/esri= magic/esri= magic/esri= magic/esrix  version %dxlength %d= type Null Shape= type Point= type PolyLine= type Polygon= type MultiPoint=  type PointZ=  type PolyLineZ= type PolygonZ= type MultiPointZ= type PointM= type PolyLineM= type PolygonM= type MultiPointM= type MultiPatch =Y PyPy2.7 byte-compiledapplication/x-bytecode.python =W python 2.7 byte-compiledapplication/x-bytecode.python =U python 2.7 byte-compiledapplication/x-bytecode.python =S python 2.7 byte-compiledapplication/x-bytecode.python =Q python 2.7 byte-compiledapplication/x-bytecode.python =O python 2.7 byte-compiledapplication/x-bytecode.python =M python 2.7 byte-compiledapplication/x-bytecode.python =K python 2.6 byte-compiledapplication/x-bytecode.python =I python 2.6 byte-compiledapplication/x-bytecode.python =G python 2.6 byte-compiledapplication/x-bytecode.python =E python 2.5 byte-compiledapplication/x-bytecode.python =C python 2.5 byte-compiledapplication/x-bytecode.python =A python 2.5 byte-compiledapplication/x-bytecode.python =? python 2.5 byte-compiledapplication/x-bytecode.python == python 2.5 byte-compiledapplication/x-bytecode.python =; python 2.5 byte-compiledapplication/x-bytecode.python =9 python 2.5 byte-compiledapplication/x-bytecode.python =7 python 2.5 byte-compiledapplication/x-bytecode.python =5 wpython 2.5 byte-compiledapplication/x-bytecode.python =3 npython 2.4 byte-compiledapplication/x-bytecode.python =1 mpython 2.4 byte-compiledapplication/x-bytecode.python =/ cpython 2.4 byte-compiledapplication/x-bytecode.python =- Ypython 2.4 byte-compiledapplication/x-bytecode.python =+ Epython 2.3 byte-compiledapplication/x-bytecode.python =) <python 2.3 byte-compiledapplication/x-bytecode.python =' ;python 2.3 byte-compiledapplication/x-bytecode.python =% .python 2.2 byte-compiledapplication/x-bytecode.python =# -python 2.2 byte-compiledapplication/x-bytecode.python =! +python 2.1 byte-compiledapplication/x-bytecode.python = *python 2.1 byte-compiledapplication/x-bytecode.python = ƈpython 2.0 byte-compiledapplication/x-bytecode.python = Ƈpython 2.0 byte-compiledapplication/x-bytecode.python = python 1.6 byte-compiledapplication/x-bytecode.python = python 1.6 byte-compiledapplication/x-bytecode.python = Npython 1.5 byte-compiledapplication/x-bytecode.python = .python 1.3 byte-compiledapplication/x-bytecode.python = python 1.4 byte-compiledapplication/x-bytecode.python = ?python 3.7 byte-compiledapplication/x-bytecode.python = >python 3.7 byte-compiledapplication/x-bytecode.python = 3python 3.6 byte-compiledapplication/x-bytecode.python = 2python 3.6 byte-compiledapplication/x-bytecode.python = 1python 3.6 byte-compiledapplication/x-bytecode.python = 0python 3.6 byte-compiledapplication/x-bytecode.python = /python 3.6 byte-compiledapplication/x-bytecode.python = -python 3.6 byte-compiledapplication/x-bytecode.python = ,python 3.6 byte-compiledapplication/x-bytecode.python = +python 3.6 byte-compiledapplication/x-bytecode.python = *python 3.6 byte-compiledapplication/x-bytecode.python = !python 3.6 byte-compiledapplication/x-bytecode.python = python 3.6 byte-compiledapplication/x-bytecode.python = python 3.5.2+ byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = vpython 3.3 byte-compiledapplication/x-bytecode.python = lpython 3.2 byte-compiledapplication/x-bytecode.python = bpython 3.2 byte-compiledapplication/x-bytecode.python =} Xpython 3.2 byte-compiledapplication/x-bytecode.python ={ Opython 3.1 byte-compiledapplication/x-bytecode.python =y Epython 3.1 byte-compiledapplication/x-bytecode.python =w ;python 3.0 byte-compiledapplication/x-bytecode.python =u 'python 3.0 byte-compiledapplication/x-bytecode.python =s python 3.0 byte-compiledapplication/x-bytecode.python =q python 3.0 byte-compiledapplication/x-bytecode.python =o python 3.0 byte-compiledapplication/x-bytecode.python =m python 3.0 byte-compiledapplication/x-bytecode.python =k python 3.0 byte-compiledapplication/x-bytecode.python =i python 3.0 byte-compiledapplication/x-bytecode.python =g python 3.0 byte-compiledapplication/x-bytecode.python =e python 3.0 byte-compiledapplication/x-bytecode.python =c python 3.0 byte-compiledapplication/x-bytecode.python =a python 3.0 byte-compiledapplication/x-bytecode.python =_ python 3.0 byte-compiledapplication/x-bytecode.python =] python 3.0 byte-compiledapplication/x-bytecode.python =[ python 3.0 byte-compiledapplication/x-bytecode.python =SPA-RISC2.0 shared executable&Tdynamically linked=U0Ndynamically linked>`V- not stripped =;PA-RISC1.1 shared executable=<dynamically linked==0Ndynamically linked>`>- not stripped = HP s200 pure executable>- version %d&save fp regs&@dynamically linked& debuggable>$not stripped =k PA-RISC1.0 shared executable=ldynamically linked=m0Ndynamically linked>`n- not stripped = HP s200 (2.x release) pure executable>- version %d>$not stripped =)a.out big-endian 32-bit pure executable>*not stripped = AppleDouble encoded Macintosh file = Plan 9 executable, MIPS R3000 =NPA-RISC2.0 executable&Odynamically linked=P0Ndynamically linked>`Q- not stripped =6PA-RISC1.1 executable&7dynamically linked=80Ndynamically linked>`9- not stripped = HP s200 executable>- version %d&save fp regs&@dynamically linked& debuggable>$not stripped =f PA-RISC1.0 executable=gdynamically linked=h0Ndynamically linked>`i- not stripped = HP s200 (2.x release) executable>- version %d>$not stripped =&a.out big-endian 32-bit executable>'not stripped =Plan 9 executable, Motorola 68k =LPA-RISC2.0 relocatable object =5PA-RISC1.1 relocatable object = HP s200 relocatable executable>- version %d>- highwater %d&save fp regs& debuggable&PIC =d PA-RISC1.0 relocatable object = #Khronos SPIR-V binary, big-endianx , version %#08xx , generator %#08x = Mac OS X Code Directoryxversion %x> flags %#xx- %d bytes =GDSII Stream file=magic/scientificxversion %d.0>version %dx.%d =E~Plan 9 object file, Intel i386 =2MPlan 9 object file, Motorola 68k =dAmigaOS outline tag = Mac OS X Code Requirement Set>containing %d itemsx- %d bytes =&JQL plugin-ROM data,= 'un-named> (named: %s = EET archiveapplication/x-eet = python 1.1/1.2 byte-compiledapplication/x-bytecode.python = python 1.0 byte-compiledapplication/x-bytecode.python =6SENNES ROM image (Wii U Virtual Console)application/x-nes-rom=.8nes-rom-image-inesmagic/console = AppleSingle encoded Macintosh file = Mac OS X Code Requirement=(opExpr)x- %d bytes =dIRCAM file (NeXT big-endian) =dIRCAM file (MIPS little-endian) =dIRCAM file (Sun big-endian) =dIRCAM file (VAX little-endian) = MJJava jmod module version 1.0application/x-java-jmod =,Kerberos Keytab file= .-keytab_entrymagic/kerberos = U Berkeley DB>V(Log, version %d, native byte-order) = Fb1Berkeley DB>G(Btree, version %d, native byte-order) = ?aBerkeley DB>@(Hash, version %d, native byte-order) = MS"Berkeley DB>N(Queue, version %d, native byte-order) =MHP-WINDOWS font>- version %d =~OpenFst binary FST datax , fst type: %sx , arc type: %sx , version: %dx , num states: %lld> , num arcs: %lld =FҋvpCLISP memory image data = Jaleo XFS filex- version %dx- [%d -x%dxx%dx=YUV422]=RGB24] =SPSS Portable Filex(%s =TCDDACT compressed data>(version %i.>$BS%i.> $BS%i)> $BS, original size: %i bytes> $BS, block size: %i bytes =OSF/Rose object =zMirage Assembler m.out executable =!XHP core file =]3SunPC 4.0 Hard Disk =DX image =GpvCLISP memory image data, other endian =lapl workspace =lAPL workspace (Ken's original?) =e HP s200 old archive =e HP s200 old archive =eHP s500 old archive =eHP old archive =8b1Berkeley DB 1.85/1.86>9(Btree, version %d, native byte-order) =#aBerkeley DBapplication/x-dbm=%magic/database>&1.86<'1.85>((Hash, version %d, native byte-order)=)magic/database>*1.86<+1.85>,(Hash, version %d, little-endian) =\~OpenFst binary FAR data, far type: sttablex, version: %d = \QVOpenFst binary FAR data, far type: stlistx, version: %d =u$BArtisan image data=v, rectangular 24-bit=w, rectangular 8-bit with colormap=x, rectangular 32-bit (24-bit with matte) =L XcForth 32-bit Dictionary,xMSerial: %#08X,xNDictionary Start: %#08X,x ODictionary Size: %d bytes,xPUser Area Start: %#08X,xQUser Area Size: %d bytes,xREntry Point: %#08X =2 TML 2301 byte-order format =0 TML 0123 byte-order format ="unknown readable demand paged pure executable = i960 b.out relocatable object>not stripped =  compiled Lisp = unknown demand paged pure executable>!not stripped = PPyramid 90x family demand paged pure executable> not stripped =3 TML 3210 byte-order format = separate object file (z8000 a.out) = pure object file (z8000 a.out) =1 TML 1032 byte-order format = PPyramid 90x family pure executable> not stripped =HP s500 pure executable>- version %d = object file (z8000 a.out) =PPyramid 90x family executable =HP s500 executable>- version %d =|HP s500 relocatable executable>}- version %d =68k Blit mpx/mux executable = overlay object file (z8000 a.out)@=+E templatemagic/c-lang=2F^[[:space:]]*template[[:space:]]*<.*>[[:space:]]*$C++ source texttext/x-c++@=+2^(import|export) ["']\./JavaScript sourceapplication/javascriptjs@=+#! /usr/local/bin/pythonPython script text executabletext/x-script.python@=+_&